[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48636.1
DDBJ      :             conserved hypothetical protein 103
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.222.1
:99 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->50 1pugB PDBj 1e-04 40.0 %
:BLT:PDB   22->72 1j8bA PDBj 5e-04 37.5 %
:RPS:SCOP  31->72 1j8bA  d.222.1.1 * 5e-08 36.6 %
:HMM:SCOP  2->98 1pugA_ d.222.1.1 * 2.2e-17 36.2 %
:RPS:PFM   7->72 PF02575 * DUF149 4e-06 34.8 %
:HMM:PFM   3->91 PF02575 * DUF149 3.2e-25 37.1 89/93  
:BLT:SWISS 11->73 Y257_BART1 8e-09 36.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48636.1 GT:GENE ABO48636.1 GT:PRODUCT conserved hypothetical protein 103 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 92362..92661 GB:FROM 92362 GB:TO 92661 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein 103 GB:NOTE PFAM: conserved hypothetical protein 103 KEGG: chy:CHY_2674 conserved hypothetical protein TIGR00103 GB:PROTEIN_ID ABO48636.1 GB:DB_XREF GI:134050665 InterPro:IPR004401 LENGTH 99 SQ:AASEQ MFGNMAKVVGQIQNIQQFLKDMTVEGTAGDGLVKVIINGQQSILAVRFDPDRISAVEPEALGQMITEAYNQAQLESKEKAKEEVTKATGLNLSNLPGIF GT:EXON 1|1-99:0| BL:SWS:NREP 1 BL:SWS:REP 11->73|Y257_BART1|8e-09|36.5|63/107| SEG 75->88|eskekakeevtkat| BL:PDB:NREP 2 BL:PDB:REP 11->50|1pugB|1e-04|40.0|40/74| BL:PDB:REP 22->72|1j8bA|5e-04|37.5|48/85| RP:PFM:NREP 1 RP:PFM:REP 7->72|PF02575|4e-06|34.8|66/93|DUF149| HM:PFM:NREP 1 HM:PFM:REP 3->91|PF02575|3.2e-25|37.1|89/93|DUF149| RP:SCP:NREP 1 RP:SCP:REP 31->72|1j8bA|5e-08|36.6|41/92|d.222.1.1| HM:SCP:REP 2->98|1pugA_|2.2e-17|36.2|94/94|d.222.1.1|1/1|YbaB-like| OP:NHOMO 4 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------21---1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 59 STR:RPRED 59.6 SQ:SECSTR ##########ccTTTHHHHHHcEEEEEEGGGTEEEEEETTccEEEEEEcG###GGGccHHHHHHHHHHHHHH########################### DISOP:02AL 1-8,73-87| PSIPRED cHHHHHHHHHHHHHHHHHHccEEEEEEEccEEEEEEEEcccEEEEEEEcHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc //