[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48640.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.17
:80 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->78 2qifB PDBj 5e-07 32.8 %
:RPS:PDB   15->76 1aw0A PDBj 2e-10 29.5 %
:RPS:SCOP  15->76 1aw0A  d.58.17.1 * 2e-10 29.5 %
:HMM:SCOP  4->79 1q8lA_ d.58.17.1 * 2.2e-08 25.3 %
:HMM:PFM   29->61 PF00403 * HMA 8.2e-09 36.4 33/62  
:BLT:SWISS 13->78 COPZ_STAS1 4e-07 30.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48640.1 GT:GENE ABO48640.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 97257..97499 GB:FROM 97257 GB:TO 97499 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO48640.1 GB:DB_XREF GI:134050669 InterPro:IPR006121 LENGTH 80 SQ:AASEQ MTGPNIQDHQNISKTFKIGGLQGSQHDKQEIETYLSQIDGVDNVKVNLEDGSVTVDFDPGAIHTDYLRGTLKSLGHNILA GT:EXON 1|1-80:0| BL:SWS:NREP 1 BL:SWS:REP 13->78|COPZ_STAS1|4e-07|30.8|65/68| BL:PDB:NREP 1 BL:PDB:REP 14->78|2qifB|5e-07|32.8|64/68| RP:PDB:NREP 1 RP:PDB:REP 15->76|1aw0A|2e-10|29.5|61/72| HM:PFM:NREP 1 HM:PFM:REP 29->61|PF00403|8.2e-09|36.4|33/62|HMA| RP:SCP:NREP 1 RP:SCP:REP 15->76|1aw0A|2e-10|29.5|61/72|d.58.17.1| HM:SCP:REP 4->79|1q8lA_|2.2e-08|25.3|75/0|d.58.17.1|1/1|HMA, heavy metal-associated domain| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 71 STR:RPRED 88.8 SQ:SECSTR #######cccccccEEEEEccccHHHHHHHHHHHHHTcTTcccEEEETTTTEEEEEEcTTTccHHHHHHHHHHHTccE## DISOP:02AL 1-2,4-8| PSIPRED cccccHHHccccEEEEEEccccHHHHHHHHHHHHHHHcccEEEEEEEEcccEEEEEEccccccHHHHHHHHHHccccccc //