[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48641.1
DDBJ      :             protein of unknown function DUF606
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.34.14
:148 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  80->130 1u04A1  b.34.14.1 * 3e-04 9.5 %
:RPS:PFM   68->138 PF04657 * DUF606 1e-06 33.8 %
:HMM:PFM   7->144 PF04657 * DUF606 1.4e-38 35.3 136/138  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48641.1 GT:GENE ABO48641.1 GT:PRODUCT protein of unknown function DUF606 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 97675..98121 GB:FROM 97675 GB:TO 98121 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF606 GB:NOTE PFAM: protein of unknown function DUF606 KEGG: mta:Moth_0102 protein of unknown function DUF606 GB:PROTEIN_ID ABO48641.1 GB:DB_XREF GI:134050670 InterPro:IPR006750 LENGTH 148 SQ:AASEQ MDAKLLALIIAAISGLTMALQGTMNSALGKVVGLWETTFIVHAVGTVVVGILVFVCRLGACDLDKWVSAPWYTYLGGLLSVVIIYMVARSMPVVGVAPATTAIIVGQVLTAAAIDHLGLFGFEQIPFSWYQVAGTFLMAGGAFLLLKK GT:EXON 1|1-148:0| TM:NTM 4 TM:REGION 1->23| TM:REGION 34->56| TM:REGION 74->96| TM:REGION 104->126| SEG 5->13|llaliiaai| SEG 38->55|tfivhavgtvvvgilvfv| RP:PFM:NREP 1 RP:PFM:REP 68->138|PF04657|1e-06|33.8|71/139|DUF606| HM:PFM:NREP 1 HM:PFM:REP 7->144|PF04657|1.4e-38|35.3|136/138|DUF606| RP:SCP:NREP 1 RP:SCP:REP 80->130|1u04A1|3e-04|9.5|42/301|b.34.14.1| OP:NHOMO 17 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------1-------12211111-11----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcc //