[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48663.1
DDBJ      :             transcriptional regulator, AbrB family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  88/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.129.1d.110.2
:186 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->185 2w1tA PDBj 6e-58 63.4 %
:RPS:PDB   1->51 1ektA PDBj 1e-10 68.0 %
:RPS:PDB   54->181 2b18A PDBj 3e-07 15.3 %
:RPS:SCOP  1->51 1yfbA1  b.129.1.3 * 6e-19 68.0 %
:RPS:SCOP  54->186 1mc0A1  d.110.2.1 * 2e-07 7.6 %
:HMM:SCOP  1->52 1yfbA1 b.129.1.3 * 1.4e-12 49.0 %
:HMM:SCOP  102->186 1f5mA_ d.110.2.1 * 1.2e-07 29.5 %
:HMM:PFM   9->52 PF04014 * SpoVT_AbrB 5.8e-14 45.5 44/47  
:HMM:PFM   98->182 PF01590 * GAF 7.3e-05 24.1 83/154  
:BLT:SWISS 1->186 SP5T_BACSU 2e-59 64.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48663.1 GT:GENE ABO48663.1 GT:PRODUCT transcriptional regulator, AbrB family GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 120469..121029 GB:FROM 120469 GB:TO 121029 GB:DIRECTION + GB:PRODUCT transcriptional regulator, AbrB family GB:NOTE TIGRFAM: transcriptional regulator, AbrB family PFAM: SpoVT/AbrB domain protein KEGG: chy:CHY_0202 stage V sporulation protein T GB:PROTEIN_ID ABO48663.1 GB:DB_XREF GI:134050692 InterPro:IPR006339 InterPro:IPR007159 LENGTH 186 SQ:AASEQ MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDREGEVILKKYSPIGELGDFAKEYADSLYEALGHIACIADRDTIIAVAGAPKKEFINKPIGPNVEKVMEDRKAVVINTPGNDPHCKECGITEDGECKYSSEVIAPIISEGDPIGAVILASKDPDVKMGEMELKLAETAAGFLAKQMEQ GT:EXON 1|1-186:0| BL:SWS:NREP 1 BL:SWS:REP 1->186|SP5T_BACSU|2e-59|64.6|178/178| BL:PDB:NREP 1 BL:PDB:REP 3->185|2w1tA|6e-58|63.4|175/175| RP:PDB:NREP 2 RP:PDB:REP 1->51|1ektA|1e-10|68.0|50/53| RP:PDB:REP 54->181|2b18A|3e-07|15.3|124/155| HM:PFM:NREP 2 HM:PFM:REP 9->52|PF04014|5.8e-14|45.5|44/47|SpoVT_AbrB| HM:PFM:REP 98->182|PF01590|7.3e-05|24.1|83/154|GAF| RP:SCP:NREP 2 RP:SCP:REP 1->51|1yfbA1|6e-19|68.0|50/51|b.129.1.3| RP:SCP:REP 54->186|1mc0A1|2e-07|7.6|132/187|d.110.2.1| HM:SCP:REP 1->52|1yfbA1|1.4e-12|49.0|51/0|b.129.1.3|1/1|AbrB/MazE/MraZ-like| HM:SCP:REP 102->186|1f5mA_|1.2e-07|29.5|78/0|d.110.2.1|1/1|GAF domain-like| OP:NHOMO 216 OP:NHOMOORG 88 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2233333344433443444344333332223211111111221-----------------------------------------------------------------------------------------22255232222222251222222312--2114222423232222222----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 186 STR:RPRED 100.0 SQ:SECSTR cccccEEEcccTTccccccHHHHHHHcccccccEEEEEETTTEEEEEEcccHHTccccHHHHHHHHHHHHTcEEEEEETTcEEEcccccccHHHHHHHHHTHHHHTTccccEEEEcTTcTTccccGGGTTTTTTEEEEEEEEEEEccccEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHH DISOP:02AL 1-2,185-187| PSIPRED ccccccEEEHHHcccEEEEHHHHHHccccccccEEEEEccccEEEEEEEccccccHHHHHHHHHHHHHHcccEEEEEcccEEEEEccccHHHHHcccHHHHHHHHHHHccEEEEEccccccccEEEEEccccccEEEEEEEEEEEEcccEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHcc //