[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48672.1
DDBJ      :             RNA binding S1 domain protein
Swiss-Prot:             

Homologs  Archaea  20/68 : Bacteria  771/915 : Eukaryota  19/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:126 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->77 2oceA PDBj 4e-17 48.0 %
:RPS:PDB   1->77 3bzkA PDBj 6e-19 45.5 %
:RPS:SCOP  3->76 1sroA  b.40.4.5 * 2e-21 44.6 %
:HMM:SCOP  3->92 1go3E1 b.40.4.5 * 4.5e-23 42.7 %
:RPS:PFM   3->73 PF00575 * S1 4e-11 47.1 %
:HMM:PFM   3->74 PF00575 * S1 2.1e-22 47.2 72/74  
:BLT:SWISS 1->125 YABR_BACSU 7e-40 65.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48672.1 GT:GENE ABO48672.1 GT:PRODUCT RNA binding S1 domain protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 126494..126874 GB:FROM 126494 GB:TO 126874 GB:DIRECTION + GB:PRODUCT RNA binding S1 domain protein GB:NOTE PFAM: RNA binding S1 domain protein KEGG: mta:Moth_0092 RNA binding S1 GB:PROTEIN_ID ABO48672.1 GB:DB_XREF GI:134050701 InterPro:IPR003029 LENGTH 126 SQ:AASEQ MSLEQGSIVEGIVTGITNFGAFVELPGGQTGLVHISEVAEVYVKDINEFLKVNDKVKVRIISVDPKGKIGLSIKQANPSANRGNRKPKFQPSFEDKLAKFMKESDERLSDLKRQTDSKRGGRGSKF GT:EXON 1|1-126:0| BL:SWS:NREP 1 BL:SWS:REP 1->125|YABR_BACSU|7e-40|65.9|123/128| BL:PDB:NREP 1 BL:PDB:REP 3->77|2oceA|4e-17|48.0|75/729| RP:PDB:NREP 1 RP:PDB:REP 1->77|3bzkA|6e-19|45.5|77/728| RP:PFM:NREP 1 RP:PFM:REP 3->73|PF00575|4e-11|47.1|70/74|S1| HM:PFM:NREP 1 HM:PFM:REP 3->74|PF00575|2.1e-22|47.2|72/74|S1| GO:PFM:NREP 1 GO:PFM GO:0003723|"GO:RNA binding"|PF00575|IPR003029| RP:SCP:NREP 1 RP:SCP:REP 3->76|1sroA|2e-21|44.6|74/76|b.40.4.5| HM:SCP:REP 3->92|1go3E1|4.5e-23|42.7|89/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 1687 OP:NHOMOORG 810 OP:PATTERN -----------------------1---------1111-11112-------111-1111111------- 2321111------111111-11111111111111111111112211-1111-11111111111--11211-1111111-12-2--11-222211--2-11-11--12122222222222211112---------1-2223311-2221221111233---1-1-112111211----11----33322--1244444444444444444334443444333344344444412322333333333232323343131331221233223223211-32211122222--111111111122211222222222211222111117445555555545531333344244342121144223353-33311-12-12122211-11112112211211211111111111-32122121221-2222222222221122-112111111211111111---1-12----11111--112211222212212----1112212222222222222222223322222222333332233322222222122112321222222222232223221232-411-3222133332233322223211-----------------------11113233232233322222323222222332231-1232-22222233333333333333333-333333332333333333333333333333322322233333333333333313333333333331-3222222----2133311111-13323122322222223333333333333333333233111-1111123332333333333322333333332222--11112222111---------------------------------1111111111-22 ------------------------------------------------------------------------------------------------------------3------------------------------------------------------------------21112111213224-11-22---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 112 STR:RPRED 88.9 SQ:SECSTR GGccTTcEEEEEEEEEETTEEEEEccccccEEEEGGGGcccccccHHHHccTTcEEEEEEEEEETTTEEEEEccTTccEEEcccEEEEccHHHHHHHHHHHHHHHHTTccHH############## DISOP:02AL 1-1,75-127| PSIPRED cccccccEEEEEEEEEEccEEEEEEccccEEEEEEEEEcccccccHHHEEccccEEEEEEEEEcccccEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc //