[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48681.1
DDBJ      :             transcriptional regulator, DeoR family
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  553/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
a.4.1a.4.5c.124.1
:253 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->75 2h09A PDBj 1e-05 36.8 %
:RPS:PDB   3->54 1bibA PDBj 3e-13 15.4 %
:RPS:PDB   25->237 3dlxB PDBj 3e-30 13.1 %
:RPS:SCOP  1->82 2jn6A1  a.4.1.19 * 3e-13 7.3 %
:RPS:SCOP  72->247 1t5oA  c.124.1.5 * 1e-22 11.8 %
:HMM:SCOP  1->80 1stzA1 a.4.5.51 * 7.9e-16 40.0 %
:HMM:SCOP  71->233 1lk5A1 c.124.1.4 * 5.2e-30 26.8 %
:RPS:PFM   5->56 PF08220 * HTH_DeoR 3e-09 53.8 %
:RPS:PFM   75->229 PF00455 * DeoR 6e-32 46.1 %
:HMM:PFM   75->229 PF00455 * DeoR 2.2e-43 42.2 154/157  
:HMM:PFM   5->59 PF08220 * HTH_DeoR 1e-21 47.3 55/57  
:BLT:SWISS 4->249 SRLR_ECOLI 4e-34 35.1 %
:PROS 5->39|PS00894|HTH_DEOR_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48681.1 GT:GENE ABO48681.1 GT:PRODUCT transcriptional regulator, DeoR family GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 138176..138937 GB:FROM 138176 GB:TO 138937 GB:DIRECTION + GB:PRODUCT transcriptional regulator, DeoR family GB:NOTE PFAM: regulatory protein GntR, HTH; regulatory protein, DeoR; regulatory protein, ArsR; Helix-turn-helix, type 11 domain protein KEGG: sth:STH793 DeoR-family transcriptional regulator GB:PROTEIN_ID ABO48681.1 GB:DB_XREF GI:134050710 InterPro:IPR000524 InterPro:IPR001034 InterPro:IPR001845 InterPro:IPR013196 LENGTH 253 SQ:AASEQ MGSERQEKIQSLLREHGNLTVAELAQRFDVSEMTIRRDLKALAALGLIQREHGRALFLQTAPDDRFFARLGEAEQEKIAIGRLAADLIAEGETIILDAGTTTLAVAQEINKSCVVITNSLPIASTLANHGDEMTVLITGGEVRGTTQALVGPMARGGFTGFNADKVFLAATGINIERGLSTDNMLESEVKQAMLDAARQVILVAHSKKFGQVYYHTFAHWNRVHTVITDAGLPENTRRELENLGVQVMIAENR GT:EXON 1|1-253:0| BL:SWS:NREP 1 BL:SWS:REP 4->249|SRLR_ECOLI|4e-34|35.1|245/257| PROS 5->39|PS00894|HTH_DEOR_1|PDOC00696| BL:PDB:NREP 1 BL:PDB:REP 7->75|2h09A|1e-05|36.8|68/127| RP:PDB:NREP 2 RP:PDB:REP 3->54|1bibA|3e-13|15.4|52/294| RP:PDB:REP 25->237|3dlxB|3e-30|13.1|213/465| RP:PFM:NREP 2 RP:PFM:REP 5->56|PF08220|3e-09|53.8|52/56|HTH_DeoR| RP:PFM:REP 75->229|PF00455|6e-32|46.1|154/157|DeoR| HM:PFM:NREP 2 HM:PFM:REP 75->229|PF00455|2.2e-43|42.2|154/157|DeoR| HM:PFM:REP 5->59|PF08220|1e-21|47.3|55/57|HTH_DeoR| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF08220|IPR001034| GO:PFM GO:0005622|"GO:intracellular"|PF08220|IPR001034| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF08220|IPR001034| RP:SCP:NREP 2 RP:SCP:REP 1->82|2jn6A1|3e-13|7.3|82/89|a.4.1.19| RP:SCP:REP 72->247|1t5oA|1e-22|11.8|169/340|c.124.1.5| HM:SCP:REP 1->80|1stzA1|7.9e-16|40.0|80/87|a.4.5.51|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 71->233|1lk5A1|5.2e-30|26.8|142/150|c.124.1.4|1/1|NagB/RpiA/CoA transferase-like| OP:NHOMO 2161 OP:NHOMOORG 559 OP:PATTERN ------------------------2--1---------------------------------------- 33--9323445111-------3---5------322212231--2822-13335461-4--213675A657311111112---1--------1--------12--14-6-A--------------------------22211----------------------------1-------------321--22-31433333334143333375442434411113335555566A2222222222222224322342-1481-22144--881411--3433343333444444444444444444444444444532221333551167332334363513--24422213-2121----1--1--42226222--12--------1-113---1311144444444445-111112221A--C665465BA8552----3224134432111111114222---4-------------------------------1---111113556532333344783333135362232--1211-1111-1324-------411111111----1---2---12--1---1-------11-----1-----------------------------5392-1111233111111122211111111-------------8587564BAADBCCCBB-ACBBABABACADBABBCB6DCD56433C9DCDCDCCBCCBCCCA988BBA93-766666556666---------------136444747223225885----------3133232534222222455----------333744444533682211111----------4-------------------------1-1------11-------41--13111-11 -------------2------------------------------------------------------------------------------------------------------------------------------------------------1----1------4---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 253 STR:RPRED 100.0 SQ:SECSTR HHcGGGcTTHHHHTTcEEEEEEEEcEEEEEEEEcEEEcTTcccGGGccccGGGccEEEEcccccccccccccccHHHHHHHHHHGGGccTTEEEEEcTTHHHHHGGGccTTcEEEEETTTEEEEcccccGGGccTTcccccEEEEEEEccHHHHHHHHHTTcccEEEEcccEEETTccEEcccccccTTHHHHTccTTcEEEEEGEEcEEccccccccccccccEEEcccEEEEEETTEEEEEEccTTHHHHc DISOP:02AL 1-3,253-254| PSIPRED ccHHHHHHHHHHHHHcccEEHHHHHHHHcccHHHHHHHHHHHHHcccEEEEccEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHcccccEEEEccHHHHHHHHHcccccEEEEEccEEEccccEEEcHHHHHHHHHccccEEEEEccccccccccccccHHHHHHHHHHHHHcccEEEEEccccccccEEEEEEcHHHccEEEccccccHHHHHHHHHcccEEEEEccc //