[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48694.1
DDBJ      :             heterodisulfide reductase subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:61 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   2->50 PF02662 * FlpD 3e-10 42.9 %
:HMM:PFM   2->51 PF02662 * FlpD 1.4e-12 38.0 50/124  
:BLT:SWISS 3->52 VHCD_METVO 7e-09 40.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48694.1 GT:GENE ABO48694.1 GT:PRODUCT heterodisulfide reductase subunit GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 157390..157575 GB:FROM 157390 GB:TO 157575 GB:DIRECTION + GB:PRODUCT heterodisulfide reductase subunit GB:NOTE KEGG: gsu:GSU0089 heterodisulfide reductase subunit GB:PROTEIN_ID ABO48694.1 GB:DB_XREF GI:134050723 LENGTH 61 SQ:AASEQ MARRKFALMKNLLNYMGVEKDRVNFTWVSASEGARFADLITDLTGKVKEMGPNKGLFRKVE GT:EXON 1|1-61:0| BL:SWS:NREP 1 BL:SWS:REP 3->52|VHCD_METVO|7e-09|40.0|50/144| RP:PFM:NREP 1 RP:PFM:REP 2->50|PF02662|3e-10|42.9|49/123|FlpD| HM:PFM:NREP 1 HM:PFM:REP 2->51|PF02662|1.4e-12|38.0|50/124|FlpD| GO:PFM:NREP 2 GO:PFM GO:0015948|"GO:methanogenesis"|PF02662|IPR003813| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02662|IPR003813| OP:NHOMO 14 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------1--------------------------------11111--11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11--------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,56-62| PSIPRED cHHHHHHHHHHHHHHccccccEEEEEEEEHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHc //