[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48725.1
DDBJ      :             S23 ribosomal protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  57/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.29.16
:124 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->120 2gscD PDBj 4e-13 34.5 %
:RPS:SCOP  10->121 2rldA1  a.29.16.1 * 1e-15 26.6 %
:RPS:PFM   12->117 PF05635 * Ribosomal_S23p 4e-21 47.6 %
:HMM:PFM   10->119 PF05635 * Ribosomal_S23p 7.7e-38 50.5 109/110  
:BLT:SWISS 32->104 RPOC_STRSY 9e-05 40.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48725.1 GT:GENE ABO48725.1 GT:PRODUCT S23 ribosomal protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 188003..188377 GB:FROM 188003 GB:TO 188377 GB:DIRECTION + GB:PRODUCT S23 ribosomal protein GB:NOTE PFAM: S23 ribosomal protein KEGG: chy:CHY_0463 intervening sequence, 23S rRNA GB:PROTEIN_ID ABO48725.1 GB:DB_XREF GI:134050754 InterPro:IPR008815 LENGTH 124 SQ:AASEQ MFERKTHMIKDYHDLEVYKRGYKLALQIHKTTKGFPQHELYEIGSQIRRAAVSIPLNIAEGYGRKNYVDDFKRFLINALGSCNEVAVLLDMIKDLGYISDQYEGFKEEYDHLGRQLNKLIQTWK GT:EXON 1|1-124:0| BL:SWS:NREP 1 BL:SWS:REP 32->104|RPOC_STRSY|9e-05|40.0|65/1215| BL:PDB:NREP 1 BL:PDB:REP 10->120|2gscD|4e-13|34.5|110/115| RP:PFM:NREP 1 RP:PFM:REP 12->117|PF05635|4e-21|47.6|105/109|Ribosomal_S23p| HM:PFM:NREP 1 HM:PFM:REP 10->119|PF05635|7.7e-38|50.5|109/110|Ribosomal_S23p| RP:SCP:NREP 1 RP:SCP:REP 10->121|2rldA1|1e-15|26.6|109/113|a.29.16.1| OP:NHOMO 93 OP:NHOMOORG 57 OP:PATTERN -------------------------------------------------------------------- 11-------------------------------------------------------------------------------------2---1-------1-326--112--------------------11----3------------1------------------134----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------8-1--1-44-------1---------------------11111111111------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1--------111-1-31-------------------------------1--------------------------------1-----------------------------------------------------------------------------------------------------1-1------------------------------------------------------------------------------1--11-11-------------22---------------------------------------3---------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 110 STR:RPRED 88.7 SQ:SECSTR #########ccGGGcHHHHHHHHHHHHHHHHHTTccGGGTTTHHHHHHHHHHHHHHHHHHHHHccc#HHHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHH#### DISOP:02AL 1-10,124-125| PSIPRED ccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHc //