[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48739.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:112 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   34->75 PF11536 * DUF3226 0.00062 19.0 42/239  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48739.1 GT:GENE ABO48739.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(205712..206050) GB:FROM 205712 GB:TO 206050 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO48739.1 GB:DB_XREF GI:134050768 LENGTH 112 SQ:AASEQ MTTPKLADLIDEYNEIKGQISFRPDYKKLADKNLARVIFCEKTVGSSHFSLIRNEDFEIIFTHRIGKKTHQATLDLNTFDPRYDNNLLLTWCPDYCELRWDYQHSCCLDSFL GT:EXON 1|1-112:0| HM:PFM:NREP 1 HM:PFM:REP 34->75|PF11536|0.00062|19.0|42/239|DUF3226| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccHHHHHHHHHHHHHcEEEEEcccHHHHHccccEEEEEEEccccccEEEEEEcccEEEEEEEEccccEEEEEEEcccccccccccEEEEEccccEEEEEccccccHHHHcc //