[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48743.1
DDBJ      :             ribonuclease III
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  206/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.149.1
:144 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->141 1u61A PDBj 4e-22 54.9 %
:RPS:PDB   29->141 2eb1A PDBj 2e-14 13.3 %
:RPS:SCOP  19->142 1u61A  a.149.1.1 * 2e-39 43.5 %
:HMM:SCOP  19->143 1u61A_ a.149.1.1 * 7.9e-37 48.8 %
:HMM:PFM   29->125 PF00636 * Ribonuclease_3 1.6e-11 24.7 97/105  
:BLT:SWISS 19->141 YAT4_SYNP1 2e-14 39.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48743.1 GT:GENE ABO48743.1 GT:PRODUCT ribonuclease III GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 209969..210403 GB:FROM 209969 GB:TO 210403 GB:DIRECTION + GB:PRODUCT ribonuclease III GB:NOTE PFAM: ribonuclease III KEGG: gka:GK0086 hypothetical protein GB:PROTEIN_ID ABO48743.1 GB:DB_XREF GI:134050772 InterPro:IPR000999 LENGTH 144 SQ:AASEQ MEKAGVNLFNDICLQHKNIKPTELPSLVLAYIGDAVYELAVRRYLVTQGSVKVNQLHKGAVRYVRAGAQARALFALEEKLTEEETAVVRRGRNAKSATLPKNADIMEYRQATALEALIGYLYLQGQQERMMEIINVVIEAINRN GT:EXON 1|1-144:0| BL:SWS:NREP 1 BL:SWS:REP 19->141|YAT4_SYNP1|2e-14|39.2|120/100| SEG 75->88|aleeklteeetavv| BL:PDB:NREP 1 BL:PDB:REP 19->141|1u61A|4e-22|54.9|122/126| RP:PDB:NREP 1 RP:PDB:REP 29->141|2eb1A|2e-14|13.3|113/171| HM:PFM:NREP 1 HM:PFM:REP 29->125|PF00636|1.6e-11|24.7|97/105|Ribonuclease_3| RP:SCP:NREP 1 RP:SCP:REP 19->142|1u61A|2e-39|43.5|124/127|a.149.1.1| HM:SCP:REP 19->143|1u61A_|7.9e-37|48.8|125/127|a.149.1.1|1/1|RNase III domain-like| OP:NHOMO 208 OP:NHOMOORG 208 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------11-111-11-----1-11-1-1111-1-1---1-1----------11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--1111-11111111111111-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------11-1111111--- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 129 STR:RPRED 89.6 SQ:SECSTR ############HTccHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHcTcccHHHHHHHHHHHccHHHHHHHHTTGGGTcccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHH### DISOP:02AL 1-3,144-145| PSIPRED cccccccHHHccccccccccHHHccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcc //