[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48752.1
DDBJ      :             LSU ribosomal protein L11P
Swiss-Prot:RL11_DESRM   RecName: Full=50S ribosomal protein L11;

Homologs  Archaea  57/68 : Bacteria  910/915 : Eukaryota  158/199 : Viruses  0/175   --->[See Alignment]
a.4.7d.47.1
:142 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->141 2k3fA PDBj 2e-55 70.9 %
:RPS:PDB   2->139 3bboK PDBj 2e-45 60.1 %
:RPS:SCOP  9->69 1mmsA2  d.47.1.1 * 5e-22 77.0 %
:RPS:SCOP  67->139 1hc8A  a.4.7.1 * 1e-24 79.5 %
:HMM:SCOP  1->84 1wibA_ d.47.1.1 * 5.2e-31 52.4 %
:HMM:SCOP  67->140 1hc8A_ a.4.7.1 * 1.4e-27 66.2 %
:RPS:PFM   9->66 PF03946 * Ribosomal_L11_N 2e-14 65.5 %
:RPS:PFM   71->139 PF00298 * Ribosomal_L11 2e-15 62.3 %
:HMM:PFM   8->66 PF03946 * Ribosomal_L11_N 8e-33 62.7 59/60  
:HMM:PFM   71->139 PF00298 * Ribosomal_L11 9.4e-33 60.9 69/69  
:BLT:SWISS 1->142 RL11_DESRM 4e-76 100.0 %
:PROS 126->141|PS00359|RIBOSOMAL_L11

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48752.1 GT:GENE ABO48752.1 GT:PRODUCT LSU ribosomal protein L11P GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 217278..217706 GB:FROM 217278 GB:TO 217706 GB:DIRECTION + GB:PRODUCT LSU ribosomal protein L11P GB:NOTE PFAM: ribosomal protein L11 KEGG: mta:Moth_2472 ribosomal protein L11 GB:PROTEIN_ID ABO48752.1 GB:DB_XREF GI:134050781 InterPro:IPR000911 InterPro:IPR006519 LENGTH 142 SQ:AASEQ MAKKVAAIIKLQIPAGKATPAPPVGPALGQHGVNIMGFVKQYNEVTAAQAGLIIPVEITVYEDRSFTFVTKTPPAAVLLKKALGIETASGEPNKKKVGKLDRSKVREIAELKMPDLNAASVEAAMRMVEGTARSMGIEIVEG GT:EXON 1|1-142:0| SW:ID RL11_DESRM SW:DE RecName: Full=50S ribosomal protein L11; SW:GN Name=rplK; OrderedLocusNames=Dred_0203; SW:KW Complete proteome; Methylation; Ribonucleoprotein; Ribosomal protein;RNA-binding; rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->142|RL11_DESRM|4e-76|100.0|142/142| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 126->141|PS00359|RIBOSOMAL_L11|PDOC00310| BL:PDB:NREP 1 BL:PDB:REP 1->141|2k3fA|2e-55|70.9|141/141| RP:PDB:NREP 1 RP:PDB:REP 2->139|3bboK|2e-45|60.1|138/145| RP:PFM:NREP 2 RP:PFM:REP 9->66|PF03946|2e-14|65.5|58/60|Ribosomal_L11_N| RP:PFM:REP 71->139|PF00298|2e-15|62.3|69/69|Ribosomal_L11| HM:PFM:NREP 2 HM:PFM:REP 8->66|PF03946|8e-33|62.7|59/60|Ribosomal_L11_N| HM:PFM:REP 71->139|PF00298|9.4e-33|60.9|69/69|Ribosomal_L11| GO:PFM:NREP 6 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF03946|IPR000911| GO:PFM GO:0005840|"GO:ribosome"|PF03946|IPR000911| GO:PFM GO:0006412|"GO:translation"|PF03946|IPR000911| GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00298|IPR000911| GO:PFM GO:0005840|"GO:ribosome"|PF00298|IPR000911| GO:PFM GO:0006412|"GO:translation"|PF00298|IPR000911| RP:SCP:NREP 2 RP:SCP:REP 9->69|1mmsA2|5e-22|77.0|61/63|d.47.1.1| RP:SCP:REP 67->139|1hc8A|1e-24|79.5|73/74|a.4.7.1| HM:SCP:REP 1->84|1wibA_|5.2e-31|52.4|82/0|d.47.1.1|1/1|Ribosomal L11/L12e N-terminal domain| HM:SCP:REP 67->140|1hc8A_|1.4e-27|66.2|74/0|a.4.7.1|1/1|Ribosomal protein L11, C-terminal domain| OP:NHOMO 1192 OP:NHOMOORG 1125 OP:PATTERN --111111111111111------1111111111111111111111111111111111111111-11-- 1111111111111111111-11111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111311111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111-11-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 11------1---111111111111111111111111-1-1-1111111111111111111111111111-1111111-1111111-11-11111111111111112--3---1--1-1-1--1-12-2-453-212111-111111-11-11111--1-11-1111-111-11112222M222124224-321131112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 142 STR:RPRED 100.0 SQ:SECSTR cccccccEEEEcccTTcccccTTTTTTTTTTcccTTccHHHHHHHGGGcccccccEEEEEcccccEEEEEccccTTHHHHHHHTcccccccTTTcccEEEcHHHHHHHHHHTcTTcccccHHHHHHHHHHHHTTTTEEEccc DISOP:02AL 1-1,84-96| PSIPRED cccEEEEEEEEEEEccccccccccHHHHHcccccHHHHHHHHHHHHHHccccEEEEEEEEEcccEEEEEEccccHHHHHHHHccccccccccccEEEEEEcHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccEEEEEc //