[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48760.1
DDBJ      :             SSU ribosomal protein S7P
Swiss-Prot:RS7_DESRM    RecName: Full=30S ribosomal protein S7;

Homologs  Archaea  19/68 : Bacteria  911/915 : Eukaryota  100/199 : Viruses  0/175   --->[See Alignment]
a.75.1
:156 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->154 1vs7G PDBj 1e-48 57.9 %
:RPS:PDB   3->155 3bbnG PDBj 3e-52 45.1 %
:RPS:SCOP  3->156 1fjgG  a.75.1.1 * 2e-52 50.6 %
:HMM:SCOP  12->156 1rssA_ a.75.1.1 * 8.7e-58 62.7 %
:RPS:PFM   3->149 PF00177 * Ribosomal_S7 2e-37 59.7 %
:HMM:PFM   1->149 PF00177 * Ribosomal_S7 1.2e-64 60.8 148/148  
:BLT:SWISS 1->156 RS7_DESRM 3e-87 100.0 %
:PROS 20->46|PS00052|RIBOSOMAL_S7

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48760.1 GT:GENE ABO48760.1 GT:PRODUCT SSU ribosomal protein S7P GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 227864..228334 GB:FROM 227864 GB:TO 228334 GB:DIRECTION + GB:PRODUCT SSU ribosomal protein S7P GB:NOTE PFAM: ribosomal protein S7 KEGG: mta:Moth_2464 ribosomal protein S7 GB:PROTEIN_ID ABO48760.1 GB:DB_XREF GI:134050789 InterPro:IPR000235 InterPro:IPR005717 LENGTH 156 SQ:AASEQ MPRRGGIPKRDVLPDPIYGSKIATKLVNQMMLDGKRGVAEKIIYDAFEIIKEKTGKSPLEVFDAAMKNVMPVLEVKARRVGGANYQVPVEVRAERRQTLGIRWMVLFTRKRAGKSMAEKLAAEIMDAANNTGATVKKREDTHKMAEANKAFAHYRW GT:EXON 1|1-156:0| SW:ID RS7_DESRM SW:DE RecName: Full=30S ribosomal protein S7; SW:GN Name=rpsG; OrderedLocusNames=Dred_0211; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding; tRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->156|RS7_DESRM|3e-87|100.0|156/156| GO:SWS:NREP 5 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| GO:SWS GO:0000049|"GO:tRNA binding"|tRNA-binding| PROS 20->46|PS00052|RIBOSOMAL_S7|PDOC00051| BL:PDB:NREP 1 BL:PDB:REP 3->154|1vs7G|1e-48|57.9|152/152| RP:PDB:NREP 1 RP:PDB:REP 3->155|3bbnG|3e-52|45.1|153/154| RP:PFM:NREP 1 RP:PFM:REP 3->149|PF00177|2e-37|59.7|144/145|Ribosomal_S7| HM:PFM:NREP 1 HM:PFM:REP 1->149|PF00177|1.2e-64|60.8|148/148|Ribosomal_S7| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00177|IPR000235| GO:PFM GO:0005622|"GO:intracellular"|PF00177|IPR000235| GO:PFM GO:0005840|"GO:ribosome"|PF00177|IPR000235| GO:PFM GO:0006412|"GO:translation"|PF00177|IPR000235| RP:SCP:NREP 1 RP:SCP:REP 3->156|1fjgG|2e-52|50.6|154/155|a.75.1.1| HM:SCP:REP 12->156|1rssA_|8.7e-58|62.7|142/145|a.75.1.1|1/1|Ribosomal protein S7| OP:NHOMO 1069 OP:NHOMOORG 1030 OP:PATTERN ---1------------1-111111--------111---------1-1--11-1---------11--1- 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 1-----1-----111-----------------------------------------------1-1111111111111111-1111111---1-1--------11-1-1--2211212111-11121121161-11311111-11111-111111--1111111111-111411112-------1--32E-12------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 155 STR:RPRED 99.4 SQ:SECSTR #ccccccccccccccTTTccccGGGHHHHcccTTcHHHHHHHHcHHHHTTTTTccccTTHHHHHHGGGTcccEEEccEEETTEEEccEEEccHHHHHHHHTTHHHHHHHTcccccHHHHHHHHHHHHHHTcHHHHHHHHHHHHHccccGGGccccc DISOP:02AL 1-10| PSIPRED ccccccccccccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccEEEEEEEEEccEEEEEEEEccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccc //