[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48765.1
DDBJ      :             LSU ribosomal protein L4P
Swiss-Prot:RL4_DESRM    RecName: Full=50S ribosomal protein L4;

Homologs  Archaea  0/68 : Bacteria  902/915 : Eukaryota  144/199 : Viruses  0/175   --->[See Alignment]
c.22.1
:206 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->206 1vs6E PDBj 1e-37 38.8 %
:RPS:PDB   1->206 3bboG PDBj 2e-61 36.4 %
:RPS:SCOP  9->206 1vs6E1  c.22.1.1 * 2e-48 36.9 %
:HMM:SCOP  2->205 1dmgA_ c.22.1.1 * 3.5e-81 58.3 %
:RPS:PFM   17->204 PF00573 * Ribosomal_L4 6e-39 49.5 %
:HMM:PFM   17->203 PF00573 * Ribosomal_L4 1.4e-77 53.5 187/192  
:BLT:SWISS 1->206 RL4_DESRM e-106 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48765.1 GT:GENE ABO48765.1 GT:PRODUCT LSU ribosomal protein L4P GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 232831..233451 GB:FROM 232831 GB:TO 233451 GB:DIRECTION + GB:PRODUCT LSU ribosomal protein L4P GB:NOTE PFAM: ribosomal protein L4/L1e KEGG: swo:Swol_2332 ribosomal protein L4/L1e GB:PROTEIN_ID ABO48765.1 GB:DB_XREF GI:134050794 InterPro:IPR002136 LENGTH 206 SQ:AASEQ MPKVALYNINGEQVGEVELKDEVFGIEPHEHVMHEAVNMQLANQRQGTHDTKTRAEVRGGGRKPWRQKGTGRARAGSSRSPIWRKGGIVFGPHPRDYAISLPKKVRRLALKSALSSKVLDQNIIVLDSLTMDAPKTKDMVRILGNLKADKALVVTATRDLNVEKSARNIEGVKPLKADGVNVYDLLKYTKLVITKDAVAKIEEVLA GT:EXON 1|1-206:0| SW:ID RL4_DESRM SW:DE RecName: Full=50S ribosomal protein L4; SW:GN Name=rplD; OrderedLocusNames=Dred_0216; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->206|RL4_DESRM|e-106|100.0|206/206| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| SEG 105->119|vrrlalksalsskvl| BL:PDB:NREP 1 BL:PDB:REP 19->206|1vs6E|1e-37|38.8|188/201| RP:PDB:NREP 1 RP:PDB:REP 1->206|3bboG|2e-61|36.4|206/211| RP:PFM:NREP 1 RP:PFM:REP 17->204|PF00573|6e-39|49.5|188/190|Ribosomal_L4| HM:PFM:NREP 1 HM:PFM:REP 17->203|PF00573|1.4e-77|53.5|187/192|Ribosomal_L4| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00573|IPR002136| GO:PFM GO:0005622|"GO:intracellular"|PF00573|IPR002136| GO:PFM GO:0005840|"GO:ribosome"|PF00573|IPR002136| GO:PFM GO:0006412|"GO:translation"|PF00573|IPR002136| RP:SCP:NREP 1 RP:SCP:REP 9->206|1vs6E1|2e-48|36.9|198/201|c.22.1.1| HM:SCP:REP 2->205|1dmgA_|3.5e-81|58.3|204/225|c.22.1.1|1/1|Ribosomal protein L4| OP:NHOMO 1115 OP:NHOMOORG 1046 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111-11111111111111111111--111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111----11111112111111111111111111-11111111111111111111111111111111 ----111-----1-111111111111111-1111111111-1111111111111-1111111------------------------11-1211111---1-11112-11123111111-1-11121111363-111-11111111-11--1--11--11111121-1111911212222H2222143531321121112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 206 STR:RPRED 100.0 SQ:SECSTR cEEEEccccccccccEEEEccccccccccTTTTTTHHHHHHHHHccccccccccTTcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHTTccccccGGGTTccccHHHHTTHHHHcccccccEEccccccccTTTccccccEEcccccccHHHHHHcccEEccTTHHHHHHHHcc DISOP:02AL 45-78| PSIPRED ccccEEEcccccEEEEEEccHHHHccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHcccccEEEEEccccccHHHHHHcccccEEEcHHHccHHHHHccccEEEEHHHHHHHHHHHc //