[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48769.1
DDBJ      :             LSU ribosomal protein L22P
Swiss-Prot:RL22_DESRM   RecName: Full=50S ribosomal protein L22;

Homologs  Archaea  0/68 : Bacteria  862/915 : Eukaryota  10/199 : Viruses  0/175   --->[See Alignment]
d.55.1
:113 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->110 2j01W PDBj 1e-29 53.6 %
:RPS:PDB   1->110 3d5bW PDBj 2e-29 53.6 %
:RPS:SCOP  2->110 1bxeA  d.55.1.1 * 3e-34 52.3 %
:HMM:SCOP  1->110 1bxeA_ d.55.1.1 * 7e-41 59.1 %
:RPS:PFM   7->109 PF00237 * Ribosomal_L22 6e-18 44.7 %
:HMM:PFM   5->108 PF00237 * Ribosomal_L22 2e-44 58.7 104/105  
:BLT:SWISS 1->113 RL22_DESRM 4e-48 100.0 %
:PROS 83->107|PS00464|RIBOSOMAL_L22
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48769.1 GT:GENE ABO48769.1 GT:PRODUCT LSU ribosomal protein L22P GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 234946..235287 GB:FROM 234946 GB:TO 235287 GB:DIRECTION + GB:PRODUCT LSU ribosomal protein L22P GB:NOTE TIGRFAM: ribosomal protein L22 PFAM: ribosomal protein L22/L17 KEGG: chy:CHY_2304 ribosomal protein L22 GB:PROTEIN_ID ABO48769.1 GB:DB_XREF GI:134050798 InterPro:IPR001063 InterPro:IPR005727 LENGTH 113 SQ:AASEQ MEAKAIAKFIRVSPRKARMVVDLIRGKKVEEALAILRYTPNKAAAAVTKVVKSAAANAEHNNDMDKEELVVSQIFVDQGPSLKRMMPRAMGRADIIKRRTSHITVVVSDKKEG GT:EXON 1|1-113:0| SW:ID RL22_DESRM SW:DE RecName: Full=50S ribosomal protein L22; SW:GN Name=rplV; OrderedLocusNames=Dred_0220; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->113|RL22_DESRM|4e-48|100.0|113/113| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 83->107|PS00464|RIBOSOMAL_L22|PDOC00387| SEG 42->58|kaaaavtkvvksaaana| BL:PDB:NREP 1 BL:PDB:REP 1->110|2j01W|1e-29|53.6|110/113| RP:PDB:NREP 1 RP:PDB:REP 1->110|3d5bW|2e-29|53.6|110/112| RP:PFM:NREP 1 RP:PFM:REP 7->109|PF00237|6e-18|44.7|103/105|Ribosomal_L22| HM:PFM:NREP 1 HM:PFM:REP 5->108|PF00237|2e-44|58.7|104/105|Ribosomal_L22| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00237|IPR001063| GO:PFM GO:0005622|"GO:intracellular"|PF00237|IPR001063| GO:PFM GO:0005840|"GO:ribosome"|PF00237|IPR001063| GO:PFM GO:0006412|"GO:translation"|PF00237|IPR001063| RP:SCP:NREP 1 RP:SCP:REP 2->110|1bxeA|3e-34|52.3|109/110|d.55.1.1| HM:SCP:REP 1->110|1bxeA_|7e-41|59.1|110/110|d.55.1.1|1/1|Ribosomal protein L22| OP:NHOMO 876 OP:NHOMOORG 872 OP:PATTERN -------------------------------------------------------------------- 111-111111111111111-11111111111111111111111111111111111111111111111111111--11111111-1111111111-----111111111-11111111111----1-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111-111111111111111111111--------1111111111111111111--1111111111111111111-111-111----------111111111111111-1---1---11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1112111111111111111111-11111111111111111111111111111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------112--1-11-111-1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 112 STR:RPRED 99.1 SQ:SECSTR cccEEEEEEEEccHHHHHHHHHHTTTccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccGGGEEEEEEEEEEEEEEEcccEETTTEEcccEEEEEEEEEEEEEccc# DISOP:02AL 1-1,111-114| PSIPRED ccEEEEEccccccHHHHHHHHHHHccccHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHccccHHHcEEEEEEEcccccccccccccccccccEEccccEEEEEEEEcccc //