[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48774.1
DDBJ      :             LSU ribosomal protein L14P
Swiss-Prot:RL14_DESRM   RecName: Full=50S ribosomal protein L14;

Homologs  Archaea  60/68 : Bacteria  906/915 : Eukaryota  163/199 : Viruses  0/175   --->[See Alignment]
b.39.1
:122 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->122 1vsaI PDBj 3e-41 77.0 %
:RPS:PDB   1->122 3bboM PDBj 6e-44 56.2 %
:RPS:SCOP  1->122 1s72K  b.39.1.1 * 9e-40 38.1 %
:HMM:SCOP  1->122 1whiA_ b.39.1.1 * 2.2e-51 63.1 %
:RPS:PFM   1->122 PF00238 * Ribosomal_L14 5e-33 63.9 %
:HMM:PFM   1->122 PF00238 * Ribosomal_L14 6.6e-55 66.4 122/122  
:BLT:SWISS 1->122 RL14_DESRM 1e-54 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48774.1 GT:GENE ABO48774.1 GT:PRODUCT LSU ribosomal protein L14P GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 236927..237295 GB:FROM 236927 GB:TO 237295 GB:DIRECTION + GB:PRODUCT LSU ribosomal protein L14P GB:NOTE TIGRFAM: ribosomal protein L14 PFAM: ribosomal protein L14b/L23e KEGG: chy:CHY_2299 ribosomal protein L14 GB:PROTEIN_ID ABO48774.1 GB:DB_XREF GI:134050803 InterPro:IPR000218 InterPro:IPR005745 LENGTH 122 SQ:AASEQ MIQVQTILKAADNTGARKLMCIRVMGGSLRRYASVGDIIVASVKEATPGGVVKKGDVVKCVVVRTSKEVRRPDGSYIKFDENAAVVIKDDKTPRGTRIFGPVARELREKDFMKIVSLAPEVI GT:EXON 1|1-122:0| SW:ID RL14_DESRM SW:DE RecName: Full=50S ribosomal protein L14; SW:GN Name=rplN; OrderedLocusNames=Dred_0225; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->122|RL14_DESRM|1e-54|100.0|122/122| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| SEG 49->63|ggvvkkgdvvkcvvv| BL:PDB:NREP 1 BL:PDB:REP 1->122|1vsaI|3e-41|77.0|122/122| RP:PDB:NREP 1 RP:PDB:REP 1->122|3bboM|6e-44|56.2|121/121| RP:PFM:NREP 1 RP:PFM:REP 1->122|PF00238|5e-33|63.9|122/122|Ribosomal_L14| HM:PFM:NREP 1 HM:PFM:REP 1->122|PF00238|6.6e-55|66.4|122/122|Ribosomal_L14| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00238|IPR000218| GO:PFM GO:0005622|"GO:intracellular"|PF00238|IPR000218| GO:PFM GO:0005840|"GO:ribosome"|PF00238|IPR000218| GO:PFM GO:0006412|"GO:translation"|PF00238|IPR000218| RP:SCP:NREP 1 RP:SCP:REP 1->122|1s72K|9e-40|38.1|118/132|b.39.1.1| HM:SCP:REP 1->122|1whiA_|2.2e-51|63.1|122/122|b.39.1.1|1/1|Ribosomal protein L14| OP:NHOMO 1285 OP:NHOMOORG 1129 OP:PATTERN 11111111111111111------1111111111111111111111111111111111111111111-- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111-1111111111111111111111111111111111111111111111111111111111111111-11-111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 2211--11522-22222221222122222222222211-111122221212222222211-1212222-223222-2---22222233-1222222111112233511112111111---111113-1-221-213--1-1--1--1-----111111-14112111113111-2313-F---127687263111111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 122 STR:RPRED 100.0 SQ:SECSTR ccccccEEEEcccccEEEEEEEEEccccccccccTTcEEEEEEEEEccccccccccEEEEEEEEccccEEcTTccEEcccccEEEEccTTcccccccccccccGGGTTTHcHHHHHHccccc PSIPRED ccccccEEEEEEccccEEEEEEEEEccccccccccccEEEEEEEEcccccEEEcccEEEEEEEEEccccccccccEEEEcccEEEEEcccccEEEEEEEcHHHHHHHHcccEEEEEcccccc //