[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48778.1
DDBJ      :             SSU ribosomal protein S8P
Swiss-Prot:RS8_DESRM    RecName: Full=30S ribosomal protein S8;

Homologs  Archaea  59/68 : Bacteria  909/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
d.140.1
:132 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->131 1seiA PDBj 2e-51 70.5 %
:RPS:PDB   3->132 3bbnH PDBj 2e-49 43.1 %
:RPS:SCOP  3->132 1i6uA  d.140.1.1 * 1e-44 31.5 %
:HMM:SCOP  2->132 1i6uA_ d.140.1.1 * 9.6e-50 54.7 %
:RPS:PFM   5->131 PF00410 * Ribosomal_S8 7e-33 57.9 %
:HMM:PFM   5->132 PF00410 * Ribosomal_S8 1.3e-53 55.5 128/129  
:BLT:SWISS 1->132 RS8_DESRM 1e-72 100.0 %
:PROS 102->119|PS00053|RIBOSOMAL_S8

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48778.1 GT:GENE ABO48778.1 GT:PRODUCT SSU ribosomal protein S8P GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 238516..238914 GB:FROM 238516 GB:TO 238914 GB:DIRECTION + GB:PRODUCT SSU ribosomal protein S8P GB:NOTE PFAM: ribosomal protein S8 KEGG: chy:CHY_2295 ribosomal protein S8 GB:PROTEIN_ID ABO48778.1 GB:DB_XREF GI:134050807 InterPro:IPR000630 LENGTH 132 SQ:AASEQ MVMTDPIADFLTRVRNANTVYHDKVEAPASNVKKAIAEILKQEGYIKDYESVEDGKQGIIRLYLKYGANKQRVITGLKRISKPGLRVYAKKDQIPRVLGGLGIAIVSTSKGIMTDKQARQSGLGGEVICYVW GT:EXON 1|1-132:0| SW:ID RS8_DESRM SW:DE RecName: Full=30S ribosomal protein S8; SW:GN Name=rpsH; OrderedLocusNames=Dred_0229; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->132|RS8_DESRM|1e-72|100.0|132/132| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 102->119|PS00053|RIBOSOMAL_S8|PDOC00052| BL:PDB:NREP 1 BL:PDB:REP 2->131|1seiA|2e-51|70.5|129/130| RP:PDB:NREP 1 RP:PDB:REP 3->132|3bbnH|2e-49|43.1|130/134| RP:PFM:NREP 1 RP:PFM:REP 5->131|PF00410|7e-33|57.9|126/127|Ribosomal_S8| HM:PFM:NREP 1 HM:PFM:REP 5->132|PF00410|1.3e-53|55.5|128/129|Ribosomal_S8| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00410|IPR000630| GO:PFM GO:0005622|"GO:intracellular"|PF00410|IPR000630| GO:PFM GO:0005840|"GO:ribosome"|PF00410|IPR000630| GO:PFM GO:0006412|"GO:translation"|PF00410|IPR000630| RP:SCP:NREP 1 RP:SCP:REP 3->132|1i6uA|1e-44|31.5|127/129|d.140.1.1| HM:SCP:REP 2->132|1i6uA_|9.6e-50|54.7|128/129|d.140.1.1|1/1|Ribosomal protein S8| OP:NHOMO 979 OP:NHOMOORG 975 OP:PATTERN 1111111-111111111------1111111111111111111111111111111111111111111-- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1------1-112--1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 131 STR:RPRED 99.2 SQ:SECSTR #ccccHHHHHHHHHHHHHHTTccEEEEEccHHHHHHTHHHHTTTccccEEEEEccccEEEEEEcccccccccccccEEEcccTTcccEEcccccccGGGTTcEEEEEEcccEEcTTHHHHHTccEEEEEEEc DISOP:02AL 1-2| PSIPRED ccccHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHccccccEEEEEccccEEEEEEEEEcccccccccccEEcccccEEEEccccHHHHHHccccEEEEEcccccccHHHHHHcccccEEEEEEc //