[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48783.1
DDBJ      :             LSU ribosomal protein L15P
Swiss-Prot:RL15_DESRM   RecName: Full=50S ribosomal protein L15;

Homologs  Archaea  0/68 : Bacteria  802/915 : Eukaryota  94/199 : Viruses  0/175   --->[See Alignment]
c.12.1
:146 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->142 1vs9J PDBj 1e-31 57.2 %
:RPS:PDB   1->146 3bboN PDBj 2e-34 45.2 %
:RPS:SCOP  1->144 1vs6L1  c.12.1.1 * 1e-45 48.3 %
:HMM:SCOP  4->144 2gyaJ1 c.12.1.1 * 4.1e-50 62.1 %
:RPS:PFM   26->142 PF00828 * Ribosomal_L18e 2e-21 59.1 %
:HMM:PFM   27->145 PF00828 * Ribosomal_L18e 2.5e-35 40.5 116/129  
:BLT:SWISS 1->146 RL15_DESRM 1e-80 100.0 %
:PROS 110->140|PS00475|RIBOSOMAL_L15

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48783.1 GT:GENE ABO48783.1 GT:PRODUCT LSU ribosomal protein L15P GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 240610..241050 GB:FROM 240610 GB:TO 241050 GB:DIRECTION + GB:PRODUCT LSU ribosomal protein L15P GB:NOTE PFAM: ribosomal protein L15 KEGG: chy:CHY_2290 ribosomal protein L15 GB:PROTEIN_ID ABO48783.1 GB:DB_XREF GI:134050812 InterPro:IPR001196 InterPro:IPR005749 LENGTH 146 SQ:AASEQ MNLSELRPAPGARKKPTRKGQGIGSGLGKTAGKGHKGQNARSGGGVRPGFEGGQMPLQRRFPKRGFTNIFKKQITAINLDELNVFEAGTEVTPELLLEAGLIKKVGDGVKILGDGILEKALTVKVHAFSKSAVEKITAAGGKAEVI GT:EXON 1|1-146:0| SW:ID RL15_DESRM SW:DE RecName: Full=50S ribosomal protein L15; SW:GN Name=rplO; OrderedLocusNames=Dred_0234; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->146|RL15_DESRM|1e-80|100.0|146/146| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 110->140|PS00475|RIBOSOMAL_L15|PDOC00386| BL:PDB:NREP 1 BL:PDB:REP 1->142|1vs9J|1e-31|57.2|138/147| RP:PDB:NREP 1 RP:PDB:REP 1->146|3bboN|2e-34|45.2|146/176| RP:PFM:NREP 1 RP:PFM:REP 26->142|PF00828|2e-21|59.1|115/129|Ribosomal_L18e| HM:PFM:NREP 1 HM:PFM:REP 27->145|PF00828|2.5e-35|40.5|116/129|Ribosomal_L18e| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00828|IPR000039| GO:PFM GO:0005622|"GO:intracellular"|PF00828|IPR000039| GO:PFM GO:0005840|"GO:ribosome"|PF00828|IPR000039| GO:PFM GO:0006412|"GO:translation"|PF00828|IPR000039| RP:SCP:NREP 1 RP:SCP:REP 1->144|1vs6L1|1e-45|48.3|143/144|c.12.1.1| HM:SCP:REP 4->144|2gyaJ1|4.1e-50|62.1|140/0|c.12.1.1|1/1|Ribosomal proteins L15p and L18e| OP:NHOMO 932 OP:NHOMOORG 896 OP:PATTERN -------------------------------------------------------------------- 111-111111111111111-111111111111111111111111111111111111111-1111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111------11-----1--1111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111--1-1-----1111111111111111111-1111111111111111111111111111-1111111-111-------------------------------------------------------------1---------11111111111111-111111111111111---1--11----11-111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-1111111--11111111111111111111111 -----11---------1---11-1-11-1----1-1-111-11-----11111111111111---1111-1111-111-11111---1-11111111111111111-121--2---------------------------------------------1--------------112112E122225214-212112112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 146 STR:RPRED 100.0 SQ:SECSTR ccccccccccccccccccccccccccccccccccccccGGGTcccccTTcccccccTTccccccccccccccccccccccccccTTTTTTTcccccccccccccccccccccccccccccccccccccTGGGTTccTTTTccEEcc DISOP:02AL 8-47| PSIPRED cccccccccccccccccccccccccccccccccccccccccccccccccEEccccccHHcccccccccccccEEEEEEHHHHHHccccccccHHHHHHcccccccccEEEEEEcccccccEEEEEEEEcHHHHHHHHHcccEEEEc //