[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48787.1
DDBJ      :             bacterial translation initiation factor 1 (bIF-1)
Swiss-Prot:IF1_DESRM    RecName: Full=Translation initiation factor IF-1;

Homologs  Archaea  0/68 : Bacteria  897/915 : Eukaryota  11/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:72 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->70 1ah9A PDBj 4e-25 69.6 %
:RPS:PDB   2->72 1ah9A PDBj 3e-20 67.6 %
:RPS:SCOP  1->71 1jt8A  b.40.4.5 * 1e-20 21.4 %
:HMM:SCOP  1->71 1hr0W_ b.40.4.5 * 7.8e-31 64.8 %
:RPS:PFM   5->70 PF01176 * eIF-1a 3e-24 75.8 %
:HMM:PFM   6->70 PF01176 * eIF-1a 5.9e-32 53.1 64/65  
:BLT:SWISS 1->72 IF1_DESRM 8e-38 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48787.1 GT:GENE ABO48787.1 GT:PRODUCT bacterial translation initiation factor 1 (bIF-1) GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 243428..243646 GB:FROM 243428 GB:TO 243646 GB:DIRECTION + GB:PRODUCT bacterial translation initiation factor 1 (bIF-1) GB:NOTE TIGRFAM: translation initiation factor IF-1 PFAM: RNA binding S1 domain protein; S1, IF1 family protein KEGG: dsy:DSY0494 hypothetical protein GB:PROTEIN_ID ABO48787.1 GB:DB_XREF GI:134050816 InterPro:IPR003029 InterPro:IPR004368 InterPro:IPR006196 LENGTH 72 SQ:AASEQ MSKNDVIEVEGKVLEPLPNAMFRVELQNGHKVLAHVSGKIRMNFIRILPGDRVTVELSPYDLTRGRIVYRFK GT:EXON 1|1-72:0| SW:ID IF1_DESRM SW:DE RecName: Full=Translation initiation factor IF-1; SW:GN Name=infA; OrderedLocusNames=Dred_0238; SW:KW Complete proteome; Cytoplasm; Initiation factor; Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->72|IF1_DESRM|8e-38|100.0|72/72| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0003743|"GO:translation initiation factor activity"|Initiation factor| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| BL:PDB:NREP 1 BL:PDB:REP 2->70|1ah9A|4e-25|69.6|69/71| RP:PDB:NREP 1 RP:PDB:REP 2->72|1ah9A|3e-20|67.6|71/71| RP:PFM:NREP 1 RP:PFM:REP 5->70|PF01176|3e-24|75.8|66/66|eIF-1a| HM:PFM:NREP 1 HM:PFM:REP 6->70|PF01176|5.9e-32|53.1|64/65|eIF-1a| GO:PFM:NREP 3 GO:PFM GO:0003723|"GO:RNA binding"|PF01176|IPR006196| GO:PFM GO:0003743|"GO:translation initiation factor activity"|PF01176|IPR006196| GO:PFM GO:0006413|"GO:translational initiation"|PF01176|IPR006196| RP:SCP:NREP 1 RP:SCP:REP 1->71|1jt8A|1e-20|21.4|70/102|b.40.4.5| HM:SCP:REP 1->71|1hr0W_|7.8e-31|64.8|71/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 989 OP:NHOMOORG 908 OP:PATTERN -------------------------------------------------------------------- 1121211111111111111-11111111111111111111111111111111111111111111111211111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1112111111111111111111111111111211111111111111111111111111111-11111111111-111111111111111111111111111111111111111111111111111--111111111111111111111222122222233232321112222222221222333312222212332121111112222221-1111111122211111112112222-11111111122221111111111111111111111111111111111111111111111111111111111111111111211111111111111111111-11-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111112111111111111111111-1111111---1-11111111111111-11121 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111------1-1-2-1111----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 72 STR:RPRED 100.0 SQ:SECSTR ccccccEEccEEEEEEccccEEEEEETTccEEEEEEcccGGGTTccccTTcEEccEEccccTTEEEEccccc DISOP:02AL 1-2| PSIPRED cccccEEEEEEEEEEEccccEEEEEEccccEEEEEEcccEEEEEEEEccccEEEEEEccccccccEEEEEEc //