[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48796.1
DDBJ      :             cobalt transport protein
Swiss-Prot:             

Homologs  Archaea  9/68 : Bacteria  216/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:269 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   19->231 PF02361 * CbiQ 5e-17 35.1 %
:HMM:PFM   16->237 PF02361 * CbiQ 2.6e-49 36.3 215/224  
:BLT:SWISS 3->240 YBAF_BACSU 4e-30 36.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48796.1 GT:GENE ABO48796.1 GT:PRODUCT cobalt transport protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 248580..249389 GB:FROM 248580 GB:TO 249389 GB:DIRECTION + GB:PRODUCT cobalt transport protein GB:NOTE PFAM: cobalt transport protein KEGG: sth:STH3043 cobalt ABC transporter permease protein GB:PROTEIN_ID ABO48796.1 GB:DB_XREF GI:134050825 InterPro:IPR003339 LENGTH 269 SQ:AASEQ MFLFSNITVGQYYPTKSIIHHMDPRAKLLAMPLIIAAVLLANHRLGYLITATMVFLAVALARVPMVSFLRGMKFLWLFLLISLILQTLTYPGEVLWQWGFLAVSREGLLLGLKLAYQLTLLILTAMLLTMTTTPVNLTGALEKLFQPFKPLGLPAHELAMMMAIALRFIPTLLEEAEAIMKAQQARGGSIAAGKLGPRLKAAVALLVPLLAGSLRRADELALAMEARCYRGDQGRTKLKQYQYKMMDFLILIVVAVITAMVILNRWGII GT:EXON 1|1-269:0| BL:SWS:NREP 1 BL:SWS:REP 3->240|YBAF_BACSU|4e-30|36.1|238/265| TM:NTM 6 TM:REGION 1->23| TM:REGION 27->49| TM:REGION 57->79| TM:REGION 103->125| TM:REGION 155->177| TM:REGION 245->267| SEG 74->89|flwlfllislilqtlt| SEG 108->133|lllglklayqltlliltamlltmttt| SEG 201->211|aavallvplla| RP:PFM:NREP 1 RP:PFM:REP 19->231|PF02361|5e-17|35.1|205/213|CbiQ| HM:PFM:NREP 1 HM:PFM:REP 16->237|PF02361|2.6e-49|36.3|215/224|CbiQ| GO:PFM:NREP 3 GO:PFM GO:0006824|"GO:cobalt ion transport"|PF02361|IPR003339| GO:PFM GO:0009236|"GO:cobalamin biosynthetic process"|PF02361|IPR003339| GO:PFM GO:0015087|"GO:cobalt ion transmembrane transporter activity"|PF02361|IPR003339| OP:NHOMO 245 OP:NHOMOORG 225 OP:PATTERN ----------------1--------------------------------1222-1-1-1-1------- -----------------------------------------------------------------------111111112222------------------------------------------------------------------1--1-----------------------------------11--1111111111111111111111111111111112222222-11111111111111111111111111111111111111111131111111111111111111111111111111111111111111111111111111111111111111111111111111--111132211111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-1-1-1-1---111111111111--1-111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED ccHHHccccccEEccccccEEccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHccc //