[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48806.1
DDBJ      :             SSU ribosomal protein S9P
Swiss-Prot:RS9_DESRM    RecName: Full=30S ribosomal protein S9;

Homologs  Archaea  0/68 : Bacteria  905/915 : Eukaryota  96/199 : Viruses  0/175   --->[See Alignment]
d.14.1
:130 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->130 1vs5I PDBj 1e-34 51.6 %
:RPS:PDB   6->130 3bbnI PDBj 6e-36 41.6 %
:RPS:SCOP  5->130 1fjgI  d.14.1.1 * 1e-36 50.0 %
:HMM:SCOP  4->130 1fjgI_ d.14.1.1 * 1.2e-47 60.6 %
:RPS:PFM   10->130 PF00380 * Ribosomal_S9 2e-28 57.9 %
:HMM:PFM   10->130 PF00380 * Ribosomal_S9 1.1e-48 55.4 121/121  
:BLT:SWISS 1->130 RS9_DESRM 2e-61 100.0 %
:PROS 69->87|PS00360|RIBOSOMAL_S9
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48806.1 GT:GENE ABO48806.1 GT:PRODUCT SSU ribosomal protein S9P GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 257873..258265 GB:FROM 257873 GB:TO 258265 GB:DIRECTION + GB:PRODUCT SSU ribosomal protein S9P GB:NOTE PFAM: ribosomal protein S9 KEGG: mta:Moth_2424 ribosomal protein S9 GB:PROTEIN_ID ABO48806.1 GB:DB_XREF GI:134050835 InterPro:IPR000754 LENGTH 130 SQ:AASEQ MAQVQFYGTGRRKNAVARVYLVPGEGKVVVNNKEVLDYFGRKTLDMVVRQPLELTNTTGRFDVLVKVVGGGVSGQAGATRHGLARALVQADPNLRPVLKRAGFLTRDPRMKERRKYGLKKARRAPQFSKR GT:EXON 1|1-130:0| SW:ID RS9_DESRM SW:DE RecName: Full=30S ribosomal protein S9; SW:GN Name=rpsI; OrderedLocusNames=Dred_0257; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->130|RS9_DESRM|2e-61|100.0|130/130| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 69->87|PS00360|RIBOSOMAL_S9|PDOC00311| SEG 63->77|vlvkvvgggvsgqag| BL:PDB:NREP 1 BL:PDB:REP 5->130|1vs5I|1e-34|51.6|126/127| RP:PDB:NREP 1 RP:PDB:REP 6->130|3bbnI|6e-36|41.6|125/127| RP:PFM:NREP 1 RP:PFM:REP 10->130|PF00380|2e-28|57.9|121/121|Ribosomal_S9| HM:PFM:NREP 1 HM:PFM:REP 10->130|PF00380|1.1e-48|55.4|121/121|Ribosomal_S9| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00380|IPR000754| GO:PFM GO:0005622|"GO:intracellular"|PF00380|IPR000754| GO:PFM GO:0005840|"GO:ribosome"|PF00380|IPR000754| GO:PFM GO:0006412|"GO:translation"|PF00380|IPR000754| RP:SCP:NREP 1 RP:SCP:REP 5->130|1fjgI|1e-36|50.0|126/127|d.14.1.1| HM:SCP:REP 4->130|1fjgI_|1.2e-47|60.6|127/127|d.14.1.1|1/1|Ribosomal protein S5 domain 2-like| OP:NHOMO 1018 OP:NHOMOORG 1001 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111--1111111111111111-11111111111111111111111111111111111111111111111111111-1-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111121111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 1---1-1-------1111-11111-111111-11111-------1-11111111111--111111111-1111-1111111111111----11-1--------111-1-1-----1----------------------------------------------11---------111--161111122431221111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 126 STR:RPRED 96.9 SQ:SECSTR ####ccccccEETTEEEEEEEEEccccEEETTEEHHHHccccGGGTTTcHHHHTTTcTTTEEEEEEEEcccHHHHHHHHHHHHHHHTTTccGGGcHHHHTTTcccccccccccccTTcccTTcccccccc DISOP:02AL 1-2,112-120,129-129| PSIPRED ccccEEEEEcccEEEEEEEEEEccccEEEEccEEHHHHcccHHHHHHHHHHHHHHcccccEEEEEEEEccccccHHHHHHHHHHHHHHHHcHHHHHHHHHcccEEccccccccccccccccccccccccc //