[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48820.1
DDBJ      :             N-acetyl-gamma-glutamyl-phosphate reductase
Swiss-Prot:ARGC_DESRM   RecName: Full=N-acetyl-gamma-glutamyl-phosphate reductase;         Short=AGPR;         EC=1.2.1.38;AltName: Full=N-acetyl-glutamate semialdehyde dehydrogenase;         Short=NAGSA dehydrogenase;

Homologs  Archaea  56/68 : Bacteria  694/915 : Eukaryota  119/199 : Viruses  0/175   --->[See Alignment]
c.2.1d.81.1
:346 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->346 1xygA PDBj 4e-82 47.4 %
:RPS:PDB   1->330 1brmB PDBj 9e-42 10.6 %
:RPS:SCOP  16->154 1vknA1  c.2.1.3 * 1e-43 46.3 %
:RPS:SCOP  150->314 1vknA2  d.81.1.1 * 2e-64 53.4 %
:RPS:SCOP  300->346 1vknA1  c.2.1.3 * 6e-09 42.6 %
:HMM:SCOP  1->182 2cvoA1 c.2.1.3 * 5.4e-56 45.0 %
:HMM:SCOP  150->314 2cvoA2 d.81.1.1 * 3e-70 56.4 %
:RPS:PFM   16->140 PF01118 * Semialdhyde_dh 2e-16 45.7 %
:RPS:PFM   159->317 PF02774 * Semialdhyde_dhC 8e-17 38.7 %
:HMM:PFM   3->141 PF01118 * Semialdhyde_dh 8e-36 43.7 119/121  
:HMM:PFM   159->317 PF02774 * Semialdhyde_dhC 7e-28 24.4 156/184  
:BLT:SWISS 1->346 ARGC_DESRM 0.0 100.0 %
:PROS 145->161|PS01224|ARGC
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48820.1 GT:GENE ABO48820.1 GT:PRODUCT N-acetyl-gamma-glutamyl-phosphate reductase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 274300..275340 GB:FROM 274300 GB:TO 275340 GB:DIRECTION + GB:PRODUCT N-acetyl-gamma-glutamyl-phosphate reductase GB:NOTE KEGG: sth:STH2892 putative N-acetyl-gamma-glutamyl-phosphate reductase TIGRFAM: N-acetyl-gamma-glutamyl-phosphate reductase PFAM: Semialdehyde dehydrogenase, NAD - binding; Semialdehyde dehydrogenase, dimerisation region GB:PROTEIN_ID ABO48820.1 GB:DB_XREF GI:134050849 InterPro:IPR000534 InterPro:IPR000706 InterPro:IPR012280 LENGTH 346 SQ:AASEQ MIKVGVVGATGYAGAELVRLLSRHPKVELTMLTSQTYAGKPMWEVFPHLYGIVDNTLEELNIPKLVANCDVIFTALPHGHAMPIAQEVMKKSKRLIDLGADFRLKDVNIYQAWYKTEHTAQLLLNNAVYGLPELYREIIKQSVIVANPGCYPTSVILGLAPLLTNEMVDTKTLIIDAKSGVSGAGRGLSLKTHFSETTNNFQAYGVATHRHTPEIEQELALLAGNPVTVSFTPHLTPMIRGILSTIYASLINNVTTEELTAIYRQFYQGERFVRVLPAGMYPTTKGVAGSNHCDISVTVDVRTKRVIVLSAIDNLIKGAAGQAVQNLNVMLGLPEDTALDFAGIYP GT:EXON 1|1-346:0| SW:ID ARGC_DESRM SW:DE RecName: Full=N-acetyl-gamma-glutamyl-phosphate reductase; Short=AGPR; EC=1.2.1.38;AltName: Full=N-acetyl-glutamate semialdehyde dehydrogenase; Short=NAGSA dehydrogenase; SW:GN Name=argC; OrderedLocusNames=Dred_0271; SW:KW Amino-acid biosynthesis; Arginine biosynthesis; Complete proteome;Cytoplasm; NADP; Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->346|ARGC_DESRM|0.0|100.0|346/346| GO:SWS:NREP 5 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0006526|"GO:arginine biosynthetic process"|Arginine biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| PROS 145->161|PS01224|ARGC|PDOC00941| SEG 4->15|vgvvgatgyaga| BL:PDB:NREP 1 BL:PDB:REP 16->346|1xygA|4e-82|47.4|329/345| RP:PDB:NREP 1 RP:PDB:REP 1->330|1brmB|9e-42|10.6|329/357| RP:PFM:NREP 2 RP:PFM:REP 16->140|PF01118|2e-16|45.7|105/120|Semialdhyde_dh| RP:PFM:REP 159->317|PF02774|8e-17|38.7|155/165|Semialdhyde_dhC| HM:PFM:NREP 2 HM:PFM:REP 3->141|PF01118|8e-36|43.7|119/121|Semialdhyde_dh| HM:PFM:REP 159->317|PF02774|7e-28|24.4|156/184|Semialdhyde_dhC| GO:PFM:NREP 8 GO:PFM GO:0005737|"GO:cytoplasm"|PF01118|IPR000534| GO:PFM GO:0006520|"GO:cellular amino acid metabolic process"|PF01118|IPR000534| GO:PFM GO:0016620|"GO:oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor"|PF01118|IPR000534| GO:PFM GO:0051287|"GO:NAD or NADH binding"|PF01118|IPR000534| GO:PFM GO:0005737|"GO:cytoplasm"|PF02774|IPR012280| GO:PFM GO:0008652|"GO:cellular amino acid biosynthetic process"|PF02774|IPR012280| GO:PFM GO:0016620|"GO:oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor"|PF02774|IPR012280| GO:PFM GO:0046983|"GO:protein dimerization activity"|PF02774|IPR012280| RP:SCP:NREP 3 RP:SCP:REP 16->154|1vknA1|1e-43|46.3|134/176|c.2.1.3| RP:SCP:REP 150->314|1vknA2|2e-64|53.4|163/163|d.81.1.1| RP:SCP:REP 300->346|1vknA1|6e-09|42.6|44/176|c.2.1.3| HM:SCP:REP 1->182|2cvoA1|5.4e-56|45.0|180/0|c.2.1.3|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 150->314|2cvoA2|3e-70|56.4|165/0|d.81.1.1|1/1|Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain| OP:NHOMO 953 OP:NHOMOORG 869 OP:PATTERN 11-1--1222112221-11111111--111111111111111111111111111111-1--1--1-11 1111211111111111111-111111111111111111111111111-1111111111--111111111211111111--11111111111111---111-1-1111111---------------11111111111222221112111111111111111111111122211111111111112222211-11111111-111111111111111111111111111111112-111111-1111111-11-1-------1---12-------11-111-------111------------------------1--111----11-11-------1-111111---1-1--111111111111-111111--1121111111-11111221111111111111111111-1121111111111111111111112111111111111121111111111111111---11111---------------------11111121112222222211122212111111221222211221111--2111-121111111111111111111-1-11111111111111111111111222211111-11111111--1-------1111111111111111111111111111111111111---11111--11111111111111111111-111111111111111111111111111111111111111111111111111--111111111111---1---------111111111-11-------1111111111111111121111222211111--------111111111111111111111111111111111111111-------------------------------------11--11111111 ----11--------11111111111-11111111111111111111111111311111111111111111111111111111111111-12111111111121111-21------------------------------------------------------2------2----1111711-1122111211131111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 346 STR:RPRED 100.0 SQ:SECSTR ccEEEEEccccHHHHHHHHHHHHTTGGGGcEEEEEEcccTTcccccTTccccccEETTcHHHHHTcHcEEEEcccHHHHHHHHHHHHTTTcccEEEEcccTTTTcTTEEEEcHHHHHHHHHHHHHcHHHHHHHHHHHHHHTTTcEEEEEEEEEEcGGGTcHHHHHHHHHHHHHHHHTTHHHHHcccccHHHHHHHHHHHHHHTTccccccccTTcHHHHHHHTTccccEEEEEEEcccccEEEEEEEEEEcccccHHHHHHHHHHHcTTcccccccHHHHHHHccHHHHcccEEEEEEcTTcTTEEEEEEEEETTcccccHHHHHHHHHHHTccTTTTcccccccc DISOP:02AL 182-192| PSIPRED cEEEEEEEcccccHHHHHHHHHccccEEEEEEEccccccEEHHHHccccccccccEEEcccHHHHHccccEEEEcccHHHHHHHHHHHHHcccEEEEcccccccccHHHHHHHcccccccHHHHHccccccccccHHHHccccEEEcccccHHHHHHHHHHHHHccccccccEEEEEEEEEcccccccccccccHHHccccccccccccEEHHHHHHHHHHHHccccEEEEEEEEccccccEEEEEEEEEcccccHHHHHHHHHHHcccccEEEEccccccccHHHHcccccEEEEEEEcccccEEEEEEEEccccHHHHHHHHHHHHHHccccHHHccccccccc //