Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48832.1
DDBJ      :             ketol-acid reductoisomerase
Swiss-Prot:ILVC_DESRM   RecName: Full=Ketol-acid reductoisomerase;         EC=;AltName: Full=Acetohydroxy-acid isomeroreductase;AltName: Full=Alpha-keto-beta-hydroxylacil reductoisomerase;

Homologs  Archaea  52/68 : Bacteria  733/915 : Eukaryota  112/199 : Viruses  0/175   --->[See Alignment]
:330 amino acids
:BLT:PDB   2->328 1np3A PDBj e-112 55.4 %
:RPS:PDB   1->50 2dwcB PDBj 8e-05 24.0 %
:RPS:PDB   49->283 2b0jA PDBj 4e-31 16.6 %
:RPS:SCOP  1->102 2a10A1  d.58.56.1 * 5e-22 20.2 %
:RPS:SCOP  73->282 1qv9A  c.127.1.1 * 2e-63 17.1 %
:HMM:SCOP  2->183 1np3A2 c.2.1.6 * 4.1e-75 64.3 %
:HMM:SCOP  184->328 1qmgA1 a.100.1.2 * 1.3e-69 61.8 %
:RPS:PFM   15->178 PF07991 * IlvN 2e-66 71.3 %
:RPS:PFM   184->327 PF01450 * IlvC 7e-49 62.2 %
:HMM:PFM   15->178 PF07991 * IlvN 2.5e-79 67.7 164/165  
:HMM:PFM   184->329 PF01450 * IlvC 1.1e-64 57.9 145/145  
:BLT:SWISS 1->330 ILVC_DESRM 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48832.1 GT:GENE ABO48832.1 GT:PRODUCT ketol-acid reductoisomerase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 291870..292862 GB:FROM 291870 GB:TO 292862 GB:DIRECTION + GB:PRODUCT ketol-acid reductoisomerase GB:NOTE KEGG: dsy:DSY1368 hypothetical protein TIGRFAM: ketol-acid reductoisomerase PFAM: acetohydroxy acid isomeroreductase; Acetohydroxy acid isomeroreductase, catalytic domain protein GB:PROTEIN_ID ABO48832.1 GB:DB_XREF GI:134050861 InterPro:IPR000506 InterPro:IPR013023 InterPro:IPR013116 LENGTH 330 SQ:AASEQ MVKVYYDADANLEFLKGKKIAVLGYGSQGHAQAQSLRDSGLDVVVGLRKDSARWSKAEADGLQVATVPDACAQAEVIQVLLPDEIQGRVYAEEIEPYLSEGKALMFSHGFNIHFGQIVPPKNVDVFLVAPKSPGHLVRRMYAEGKGVPGLVAVHQDYTGKAKDIALAYAKGIGCTKAGVFETSFREETETDLFGEQAVLCGGVSELIKAGFDTLVEAGYAPEMAYFECLHELKLIVDLIYEGGLSRMRYSVSNTAEYGDYMIGPRIVNEETREEMRQVLMEIQDGTFARNWMLENQVKSPQFNAVRKMEQEHPIEEVGARLREMMPWLKK GT:EXON 1|1-330:0| SW:ID ILVC_DESRM SW:DE RecName: Full=Ketol-acid reductoisomerase; EC=;AltName: Full=Acetohydroxy-acid isomeroreductase;AltName: Full=Alpha-keto-beta-hydroxylacil reductoisomerase; SW:GN Name=ilvC; OrderedLocusNames=Dred_0283; SW:KW Amino-acid biosynthesis; Branched-chain amino acid biosynthesis;Complete proteome; NADP; Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->330|ILVC_DESRM|0.0|100.0|330/330| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0009082|"GO:branched chain family amino acid biosynthetic process"|Branched-chain amino acid biosynthesis| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| BL:PDB:NREP 1 BL:PDB:REP 2->328|1np3A|e-112|55.4|327/327| RP:PDB:NREP 2 RP:PDB:REP 1->50|2dwcB|8e-05|24.0|50/409| RP:PDB:REP 49->283|2b0jA|4e-31|16.6|217/344| RP:PFM:NREP 2 RP:PFM:REP 15->178|PF07991|2e-66|71.3|164/165|IlvN| RP:PFM:REP 184->327|PF01450|7e-49|62.2|143/145|IlvC| HM:PFM:NREP 2 HM:PFM:REP 15->178|PF07991|2.5e-79|67.7|164/165|IlvN| HM:PFM:REP 184->329|PF01450|1.1e-64|57.9|145/145|IlvC| GO:PFM:NREP 6 GO:PFM GO:0004455|"GO:ketol-acid reductoisomerase activity"|PF07991|IPR013116| GO:PFM GO:0008652|"GO:cellular amino acid biosynthetic process"|PF07991|IPR013116| GO:PFM GO:0055114|"GO:oxidation reduction"|PF07991|IPR013116| GO:PFM GO:0004455|"GO:ketol-acid reductoisomerase activity"|PF01450|IPR000506| GO:PFM GO:0009082|"GO:branched chain family amino acid biosynthetic process"|PF01450|IPR000506| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01450|IPR000506| RP:SCP:NREP 2 RP:SCP:REP 1->102|2a10A1|5e-22|20.2|89/104|d.58.56.1| RP:SCP:REP 73->282|1qv9A|2e-63|17.1|187/282|c.127.1.1| HM:SCP:REP 2->183|1np3A2|4.1e-75|64.3|182/0|c.2.1.6|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 184->328|1qmgA1|1.3e-69|61.8|144/288|a.100.1.2|1/1|6-phosphogluconate dehydrogenase C-terminal domain-like| OP:NHOMO 973 OP:NHOMOORG 897 OP:PATTERN ---1--1122222231-11111111--11111111111111111121111111111-----1--1-11 1111111111111111111-111111111111111111111111111-111111111111112111112112111222-11-111111111111---11--111111111---------------11111111111111111111111111111111111111111111111111111111111111111-11122222222122222211111122211111--1111111111111111111111111111---------------------1-111-------11111111111111-------------111111111-11-11-------1-111221---1-1--111111111111-111111--1-11111111111111111111111111111111111-11111111111-111111111111111121111111111111111111111111111---------------------------11111111111111111122211111222212111111111111111111111111111111111111111111111-1111111111111-1111111111111-1121111111111111111111111111111111111-1111111111111111111111-1-111111111111111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111-----------11111111111-11111111111111111111111111111111111111-1-1111-111111111111111111111111111111111111111--------------------------------------1--1-111121 --------------1111111111111-111111111111111-1111111111111-1111111111-11111111-1111111111-24211211111111212--1----------------------------------------------------------------1-1111F1111122241111111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 330 STR:RPRED 100.0 SQ:SECSTR HHHHccGGGccccHHccEEEEEEcccHHHHHHHHHTTcTTEEEEEEEcTEEEEcccGGGGTcEEEccHHHHTTccEEEEccTTcTTHHHHHHHHGGGccTTcEEEEccccHHHHHHHHHccHHHHHHHHHHTTcTTcEEEEccccccTTTcccEEEEEccccHHHHHHHHcTTTcHHHHHHHccEEEEEHHHHHHHHcTTHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcGGGHHHHccGGGGGGTGGGGcGEEcGGGTTHHHHHHHHHHccccccHHHHHHHTEEEcccTTcccHHHHHHHHHHHHHcccccEccT DISOP:02AL 329-331| PSIPRED ccEEEEccccccccccccEEEEEEEcccHHHHHHHHHHcccEEEEEEEcccccHHHHHHcccEEccHHHHHHHccEEEEEccHHHHHHHHHHHHHHHcccccEEEEccccccEEcEEEcccccEEEEEccccccHHHHHHHHHccccEEEEEEEEcccccHHHHHHHHHHHcccccHHHHHccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHcccHHHcccEEHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHHHHHcc //