[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48850.1
DDBJ      :             transposase IS3/IS911 family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  34/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.12
:147 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->85 2znzC PDBj 8e-05 32.9 %
:RPS:SCOP  1->50 2oa4A1  a.4.12.3 * 8e-04 14.3 %
:HMM:PFM   2->54 PF01527 * Transposase_8 2.5e-11 38.5 52/76  
:HMM:PFM   60->123 PF01527 * Transposase_8 0.00024 25.0 60/76  
:BLT:SWISS 4->56 Y4RG_RHISN 5e-05 34.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48850.1 GT:GENE ABO48850.1 GT:PRODUCT transposase IS3/IS911 family protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 317712..318155 GB:FROM 317712 GB:TO 318155 GB:DIRECTION + GB:PRODUCT transposase IS3/IS911 family protein GB:NOTE PFAM: transposase IS3/IS911 family protein KEGG: aeh:Mlg_2330 hypothetical protein GB:PROTEIN_ID ABO48850.1 GB:DB_XREF GI:134050879 InterPro:IPR002514 LENGTH 147 SQ:AASEQ MTRYSDEFKYSIIKRMMPPNNESVKAISKETGLSEGTLHAWKKKARANGIAVPSGEPEAERWSTQDKFLIVVETASLSEIEMAEYCRSKGLFVEQVEAWRDACMQANGGIAQQAAQLQKDLRQKDRLNIAIGKSQLCHIFEPLMTSN GT:EXON 1|1-147:0| BL:SWS:NREP 1 BL:SWS:REP 4->56|Y4RG_RHISN|5e-05|34.6|52/135| SEG 105->118|qanggiaqqaaqlq| BL:PDB:NREP 1 BL:PDB:REP 7->85|2znzC|8e-05|32.9|79/144| HM:PFM:NREP 2 HM:PFM:REP 2->54|PF01527|2.5e-11|38.5|52/76|Transposase_8| HM:PFM:REP 60->123|PF01527|0.00024|25.0|60/76|Transposase_8| RP:SCP:NREP 1 RP:SCP:REP 1->50|2oa4A1|8e-04|14.3|49/93|a.4.12.3| OP:NHOMO 126 OP:NHOMOORG 34 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------212---3--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--1-2-----------------------------------------------------------------------------------4------------------------------------------------------------B---------------------------------5-F---1-------------------------------------------1---2-----------------------------------11-4-4--------P---3-----3-----------4-----------4--------------------------------------------------------------------11111111-2----------------------------------------------------------------------------------E---1------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 80 STR:RPRED 54.4 SQ:SECSTR #####ccHHHHHHHHHHHcTTccHHHHHHHHcccHHHHHHHHHHHHHHTcccccccTTTTTccEEEEEEEEEcTTcHHHHHHHTc############################################################## DISOP:02AL 1-1,45-60,146-148| PSIPRED cccccHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHcHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //