[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48870.1
DDBJ      :             transcriptional regulator, Fis family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:183 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   27->74 PF10228 * DUF2228 3e-04 31.2 %
:HMM:PFM   69->92 PF10925 * DUF2680 2.5e-05 37.5 24/59  
:HMM:PFM   111->179 PF08646 * Rep_fac-A_C 0.00018 20.3 69/146  
:BLT:SWISS 11->89 Y3456_BURPP 5e-04 31.1 %
:REPEAT 2|47->94|121->166

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48870.1 GT:GENE ABO48870.1 GT:PRODUCT transcriptional regulator, Fis family GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 336431..336982 GB:FROM 336431 GB:TO 336982 GB:DIRECTION + GB:PRODUCT transcriptional regulator, Fis family GB:NOTE KEGG: mta:Moth_1011 hypothetical protein GB:PROTEIN_ID ABO48870.1 GB:DB_XREF GI:134050899 InterPro:IPR002197 LENGTH 183 SQ:AASEQ MLKISKKIVGLAIGGMFLAGSIAGNAFADSDTKNELDQKREQYYQKFVADFATNLGVSQDQVTAALKATKKQMVQAEVQQGKITQAQADKILEQKEIGFSFGFGMGGPRHDRGDLTQNTNFLNDAASALGITADELKSELQSGKKLDQVITDQGMTMEQFRQKMPQPKFNKKDAATKNISNQS GT:EXON 1|1-183:0| BL:SWS:NREP 1 BL:SWS:REP 11->89|Y3456_BURPP|5e-04|31.1|74/251| NREPEAT 1 REPEAT 2|47->94|121->166| RP:PFM:NREP 1 RP:PFM:REP 27->74|PF10228|3e-04|31.2|48/249|DUF2228| HM:PFM:NREP 2 HM:PFM:REP 69->92|PF10925|2.5e-05|37.5|24/59|DUF2680| HM:PFM:REP 111->179|PF08646|0.00018|20.3|69/146|Rep_fac-A_C| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,32-38,167-184| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHcccHHHHHHHHHccHHHHHHHHHccccHHHHHHHccHHHHHHHHHHHHcccccc //