[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48871.1
DDBJ      :             two component transcriptional regulator, winged helix family
Swiss-Prot:             

Homologs  Archaea  25/68 : Bacteria  862/915 : Eukaryota  67/199 : Viruses  0/175   --->[See Alignment]
a.4.6c.23.1
:227 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->225 2oqrA PDBj 3e-39 37.3 %
:RPS:PDB   7->222 3c3wB PDBj 7e-32 21.8 %
:RPS:SCOP  5->122 1a0oA  c.23.1.1 * 2e-31 29.7 %
:RPS:SCOP  132->225 1gxpA  a.4.6.1 * 1e-20 29.8 %
:HMM:SCOP  4->192 1s8nA_ c.23.1.1 * 5.4e-43 31.7 %
:RPS:PFM   9->117 PF00072 * Response_reg 1e-21 45.9 %
:RPS:PFM   153->224 PF00486 * Trans_reg_C 4e-11 41.7 %
:HMM:PFM   9->117 PF00072 * Response_reg 7.8e-34 39.4 109/112  
:HMM:PFM   153->223 PF00486 * Trans_reg_C 1.8e-24 42.3 71/77  
:BLT:SWISS 8->225 PHOP_BACSU 2e-44 42.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48871.1 GT:GENE ABO48871.1 GT:PRODUCT two component transcriptional regulator, winged helix family GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 337349..338032 GB:FROM 337349 GB:TO 338032 GB:DIRECTION + GB:PRODUCT two component transcriptional regulator, winged helix family GB:NOTE PFAM: response regulator receiver; transcriptional regulator domain protein KEGG: dsy:DSY4317 hypothetical protein GB:PROTEIN_ID ABO48871.1 GB:DB_XREF GI:134050900 InterPro:IPR001789 InterPro:IPR001867 LENGTH 227 SQ:AASEQ MKQLKGIRILLVDDESNILQFLEIGLQNEGFEVQTAQDGMSAITLMKQFQPHVVILDVMMPGMDGFEVCRMLKKTENVAVIMLTARDEVDDRVKGLNLGADDYMVKPFSFEELLARIYARIRNQFPNLFGKVVVGPFQIDDRRKEIQFENRVLELSHTEYELLKFLVLNHGLVLSKTMILDKVWGYDFGGEENIVEVYIRSLRDKLNDKNHQIIRTLRRSGYRVDLS GT:EXON 1|1-227:0| BL:SWS:NREP 1 BL:SWS:REP 8->225|PHOP_BACSU|2e-44|42.7|218/240| BL:PDB:NREP 1 BL:PDB:REP 9->225|2oqrA|3e-39|37.3|217/226| RP:PDB:NREP 1 RP:PDB:REP 7->222|3c3wB|7e-32|21.8|202/210| RP:PFM:NREP 2 RP:PFM:REP 9->117|PF00072|1e-21|45.9|109/111|Response_reg| RP:PFM:REP 153->224|PF00486|4e-11|41.7|72/77|Trans_reg_C| HM:PFM:NREP 2 HM:PFM:REP 9->117|PF00072|7.8e-34|39.4|109/112|Response_reg| HM:PFM:REP 153->223|PF00486|1.8e-24|42.3|71/77|Trans_reg_C| GO:PFM:NREP 7 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00486|IPR001867| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00486|IPR001867| GO:PFM GO:0003677|"GO:DNA binding"|PF00486|IPR001867| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00486|IPR001867| RP:SCP:NREP 2 RP:SCP:REP 5->122|1a0oA|2e-31|29.7|118/128|c.23.1.1| RP:SCP:REP 132->225|1gxpA|1e-20|29.8|94/103|a.4.6.1| HM:SCP:REP 4->192|1s8nA_|5.4e-43|31.7|189/190|c.23.1.1|1/1|CheY-like| OP:NHOMO 16247 OP:NHOMOORG 954 OP:PATTERN -----------------------8-----3-1--23--3333396-6R2C837-2-2112-------1 Dee8d466778655DDDCC-CJ55DDCCCCCAKHJIBJJIFMHOFA778BBBEFG45711KJS8T7NaSZB544496658IB8359A9MMka-K22---A6T8GGgEeDX1---------11112423875594D4gkllfKAGq9*l**mlIRRJK978AD9VhPO***R685665675655GHAAA573BEObbdcdbceKfZeecYLVLJGJcglDFIfCIHBAABACz*8BCABAA9AABBBAA79997D675CC655466677CC655675686DEDA769CAA999999A99996666677778766B986648788EhQSsSSSYXWYWURMiYYBGIEdQR8BJKQK8pkaOIBB9BCC8CG42AWUMOLLI66766ILaYaKGLOVKQQDDBCDCDCCCG-RUYQTRQYFQD2WRRRQNQWWSPMJOCFCGDKMHLKIHEEEEEEEEEEFECBXLF4433333322334433344444434222239JNBBEHGDKYaccgYUMMMIXXgjOMOOGOfajXbae24PVTjLTIHjTSWSAPVTIMJLVD3433323CACMb*L**eLFrYEurTSb4*p*nmorTVcYmd**OdS9A95777777343433333OXCFOBBVNESYWYBROITNTUSORSVUTOVTQSRca--8EDDG------IHGHIIEHHHJHJJKGH-HJHGIIIGIIHIHHHGHHFMMMGICBAJIJKJLJJIKJJJJKJOGFGFFGHA1GKKKLLLKLLLL--2H343336757FLwEa444333244443116GFDEG9EABDOQjfkifontZjmonYfei321213212EIKKXPQQQQRUYaaVXPNRNOMNO9989--*4JJAACC33323323512-------------------------7B577868785X3 ----33--------51---2---1-11-------1----------------111----------11111-111-1111111112-1-------14-2121112245--21------------------------------------------------3----2-1-------7-2352A1112-D6AP-6523C---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 226 STR:RPRED 99.6 SQ:SECSTR cccHHHEEEEEEcccHHHHHHHHHHHHTcTEEEEEEccHHHHHHHHHHHcccEEEEccEETTEEHHHHHHHHHHHcTcEEEEGGGcccHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHGccHHHHHHHHHHHTTTHHHHHHHHccTTTTccHHHHHHHHHHTTTccHHHHHHHHcHHHHHHHHTccHHHHHHHHHHHHHHTTccccHHHHHHHHHTcEEcc# DISOP:02AL 1-5,125-130| PSIPRED cccccccEEEEEEccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHcccccEEEEEccccHHHHHHHHHcccccEEEccccHHHHHHHHHHHHHcccccccccEEEccEEEEcccEEEEEccEEEcccHHHHHHHHHHHHcccccccHHHHHHHHcccccccccccHHHHHHHHHHHcccccccEEEEEcccEEEEEcc //