[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48875.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:82 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   31->66 PF02002 * TFIIE_alpha 0.00014 36.1 36/105  
:HMM:PFM   5->43 PF08874 * DUF1835 0.00025 17.9 39/124  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48875.1 GT:GENE ABO48875.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(341879..342127) GB:FROM 341879 GB:TO 342127 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO48875.1 GB:DB_XREF GI:134050904 LENGTH 82 SQ:AASEQ MKSNLQEYNERLRRIEEQKSAGKIKLWHLMNHEERISVMRLLYIKENLLEEDIAHLLETEPTELQKFRRRQGTLFFQKPHPE GT:EXON 1|1-82:0| HM:PFM:NREP 2 HM:PFM:REP 31->66|PF02002|0.00014|36.1|36/105|TFIIE_alpha| HM:PFM:REP 5->43|PF08874|0.00025|17.9|39/124|DUF1835| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8,11-13,15-15,17-19,78-78,80-83| PSIPRED cccHHHHHHHHHHHHHHHHccccEEHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccEEEcccccc //