[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48876.1
DDBJ      :             protein of unknown function DUF6, transmembrane
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  84/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:151 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  65->145 1s7bA  f.39.1.1 * 7e-05 12.3 %
:HMM:SCOP  39->145 1s7bA_ f.39.1.1 * 2.4e-16 28.6 %
:RPS:PFM   15->135 PF00892 * EamA 7e-08 32.2 %
:HMM:PFM   15->137 PF00892 * EamA 1.1e-29 29.5 122/126  
:BLT:SWISS 5->112 Y510_ARCFU 9e-13 34.3 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48876.1 GT:GENE ABO48876.1 GT:PRODUCT protein of unknown function DUF6, transmembrane GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(342698..343153) GB:FROM 342698 GB:TO 343153 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF6, transmembrane GB:NOTE PFAM: protein of unknown function DUF6, transmembrane KEGG: mmp:MMP0210 hypothetical protein GB:PROTEIN_ID ABO48876.1 GB:DB_XREF GI:134050905 InterPro:IPR000620 LENGTH 151 SQ:AASEQ MSAKRVYILMVLAALFWSGAFITGKLAVREFPPFALTFFRFSFALPFVLWEKPLTYLPNATTEGWLAILYMAVFASVLGYLFQLIAIQNIGAPKAAIFINLVPVFTIMQSLLFLGEPFSWFKMLSACIIVTGVYLTTRPESGVKEAAGIKA GT:EXON 1|1-151:0| BL:SWS:NREP 1 BL:SWS:REP 5->112|Y510_ARCFU|9e-13|34.3|105/289| TM:NTM 4 TM:REGION 6->28| TM:REGION 34->56| TM:REGION 64->86| TM:REGION 95->117| RP:PFM:NREP 1 RP:PFM:REP 15->135|PF00892|7e-08|32.2|121/125|EamA| HM:PFM:NREP 1 HM:PFM:REP 15->137|PF00892|1.1e-29|29.5|122/126|EamA| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF00892|IPR000620| RP:SCP:NREP 1 RP:SCP:REP 65->145|1s7bA|7e-05|12.3|81/106|f.39.1.1| HM:SCP:REP 39->145|1s7bA_|2.4e-16|28.6|105/106|f.39.1.1|1/1|Multidrug resistance efflux transporter EmrE| OP:NHOMO 109 OP:NHOMOORG 88 OP:PATTERN -----------------------1--------------1-11-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-112112221112212------3211121---------51-----------------------------------------------------------------------------------111---1-1---1111111-1----------------------2--1-1----------------------111---1-11---------------------11---111-1111-111-----------------------------------------------------------1-------------------------------1------------------------2-1---1----------112----1-1---1111---------1-----------------------------------------------2111------------------1--------------------------------------------------1---------------------------------------------------------1-----------------------------------1-------------------11------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,137-152| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccccc //