[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48877.1
DDBJ      :             D-serine dehydratase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  115/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.79.1
:110 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   3->106 1e5xB PDBj 4e-04 6.5 %
:RPS:SCOP  37->101 1vb3A1  c.79.1.1 * 3e-04 13.6 %
:HMM:SCOP  18->104 1p5jA_ c.79.1.1 * 7.9e-05 27.2 %
:HMM:PFM   18->59 PF00291 * PALP 8.8e-06 35.7 42/297  
:HMM:PFM   67->100 PF02512 * UK 0.00095 32.4 34/156  
:BLT:SWISS 17->105 SDHD_BACST 4e-27 61.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48877.1 GT:GENE ABO48877.1 GT:PRODUCT D-serine dehydratase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 343485..343817 GB:FROM 343485 GB:TO 343817 GB:DIRECTION + GB:PRODUCT D-serine dehydratase GB:NOTE KEGG: gka:GK1922 D-serine dehydratase GB:PROTEIN_ID ABO48877.1 GB:DB_XREF GI:134050906 LENGTH 110 SQ:AASEQ MRGWWRTGGCNLWFKTSGVYTVDDDELYLLLSSLIDTEDIRLEPSALAGVAGPVRLFKEPAGQKYLEANNLKHKTSNATHIAWATGGSMVPAEVMASYYKKGLNIPVTRK GT:EXON 1|1-110:0| BL:SWS:NREP 1 BL:SWS:REP 17->105|SDHD_BACST|4e-27|61.8|89/459| SEG 23->36|dddelylllsslid| RP:PDB:NREP 1 RP:PDB:REP 3->106|1e5xB|4e-04|6.5|92/420| HM:PFM:NREP 2 HM:PFM:REP 18->59|PF00291|8.8e-06|35.7|42/297|PALP| HM:PFM:REP 67->100|PF02512|0.00095|32.4|34/156|UK| RP:SCP:NREP 1 RP:SCP:REP 37->101|1vb3A1|3e-04|13.6|59/428|c.79.1.1| HM:SCP:REP 18->104|1p5jA_|7.9e-05|27.2|81/0|c.79.1.1|1/1|Tryptophan synthase beta subunit-like PLP-dependent enzymes| OP:NHOMO 118 OP:NHOMOORG 115 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111---1111-111---------1----------------------------------------------------------------------------------------------------------------------------11-1-----------1-------------------------------------------------------1--------------------------------------------------------------------------------------------------1-----------------1-----------1-------------------1-----------------------------------------------------1-----1------------------1-----------------1-1--1-1111122111-11111-1121111111111111--111111111111111111111111111--1--------------------------1-1------------11-------------1111----1---------------------1111111----------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 92 STR:RPRED 83.6 SQ:SECSTR ##TTTTccccccHHHHHHHTcEEEEEcHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHTTcccT############TccEEEEEcccGGGGHHHHHHHHTTccTTc#### DISOP:02AL 1-2,109-111| PSIPRED ccccccccccEEEEEEEEEEEEccHHHHHHHHHHHHHcccEEcHHHHHcccccHHHcccHHHHHHHHccccccccccEEEEEEEcccccccHHHHHHHHHHccccccccc //