[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48879.1
DDBJ      :             Phosphotransferase system, phosphocarrier protein HPr
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  189/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.94.1
:87 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->67 1qr5A PDBj 6e-14 46.3 %
:RPS:PDB   1->67 1cm3A PDBj 4e-14 34.8 %
:RPS:SCOP  1->67 1cm2A  d.94.1.1 * 2e-11 38.8 %
:HMM:SCOP  1->87 1ptfA_ d.94.1.1 * 1.7e-25 48.3 %
:RPS:PFM   2->67 PF00381 * PTS-HPr 4e-12 53.0 %
:HMM:PFM   1->82 PF00381 * PTS-HPr 1.3e-33 51.2 82/84  
:BLT:SWISS 1->67 PTHP_STACA 2e-13 46.3 %
:PROS 13->20|PS00369|PTS_HPR_HIS
:PROS 39->54|PS00589|PTS_HPR_SER
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48879.1 GT:GENE ABO48879.1 GT:PRODUCT Phosphotransferase system, phosphocarrier protein HPr GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(345524..345787) GB:FROM 345524 GB:TO 345787 GB:DIRECTION - GB:PRODUCT Phosphotransferase system, phosphocarrier protein HPr GB:NOTE TIGRFAM: phosphocarrier, HPr family PFAM: phosphocarrier HPr protein KEGG: oih:OB2344 PTS system, histidine-containing phosphocarrier protein (HPr protein) GB:PROTEIN_ID ABO48879.1 GB:DB_XREF GI:134050908 InterPro:IPR000032 InterPro:IPR001020 InterPro:IPR002114 InterPro:IPR005698 LENGTH 87 SQ:AASEQ MIKQVVTIVNPTGIHARPAAHIAKLAAQFDAAIKLAYKGKEIDAKSIIGVMSLAAQAGEELLVSAEGNQAEAAVNALANLLSKPFTE GT:EXON 1|1-87:0| BL:SWS:NREP 1 BL:SWS:REP 1->67|PTHP_STACA|2e-13|46.3|67/88| PROS 13->20|PS00369|PTS_HPR_HIS|PDOC00318| PROS 39->54|PS00589|PTS_HPR_SER|PDOC00318| SEG 68->81|nqaeaavnalanll| BL:PDB:NREP 1 BL:PDB:REP 1->67|1qr5A|6e-14|46.3|67/88| RP:PDB:NREP 1 RP:PDB:REP 1->67|1cm3A|4e-14|34.8|66/84| RP:PFM:NREP 1 RP:PFM:REP 2->67|PF00381|4e-12|53.0|66/83|PTS-HPr| HM:PFM:NREP 1 HM:PFM:REP 1->82|PF00381|1.3e-33|51.2|82/84|PTS-HPr| GO:PFM:NREP 2 GO:PFM GO:0005351|"GO:sugar:hydrogen symporter activity"|PF00381|IPR005698| GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF00381|IPR005698| RP:SCP:NREP 1 RP:SCP:REP 1->67|1cm2A|2e-11|38.8|67/85|d.94.1.1| HM:SCP:REP 1->87|1ptfA_|1.7e-25|48.3|87/87|d.94.1.1|1/1|HPr-like| OP:NHOMO 194 OP:NHOMOORG 190 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------11---1---------------1-----11---1--------------------------1----------------111111111111---------------------------------------------------1-1211------1-1-1---1111111--11--12-1111111211111111111111111111111-1111-11---11111--111111-------11111111111111-------------111111111-1---1-----------1--11111--1---------1--1------11--1--111------------------------------------------------------------------------------------------------------------------------------1111111111111111111111111111111111-1-11--------11-1----------------------1---111--1-1111----------------------------------------11-----1-----------------------111-------------------------------------------------------------------------------------------1------------1------------------------------------------------------------------------------------------------------11-------------------------------1----1-1 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 67 STR:RPRED 77.0 SQ:SECSTR cEEEEEEEcccccccHHHHHHHHHHHHTcccEEEEEETTEEEETTcHHHHTTccccTTcEEEEEEEc#################### DISOP:02AL 1-1,86-88| PSIPRED cEEEEEEEEccccccHHHHHHHHHHHHccccEEEEEEccEEEEHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHHHHHHccccc //