[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48881.1
DDBJ      :             transcriptional antiterminator, BglG
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  198/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.142.1b.35.2
:282 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->56 1auuA PDBj 2e-05 37.0 %
:BLT:PDB   64->277 1h99A PDBj 6e-31 31.3 %
:RPS:PDB   10->57 1auuA PDBj 1e-09 36.2 %
:RPS:SCOP  10->56 1auuA  b.35.2.1 * 3e-10 37.0 %
:RPS:SCOP  69->173 1h99A1  a.142.1.1 * 3e-20 39.0 %
:RPS:SCOP  176->279 1h99A2  a.142.1.1 * 5e-15 24.0 %
:HMM:SCOP  8->62 1l1cA_ b.35.2.1 * 9.9e-13 45.5 %
:HMM:SCOP  61->175 1h99A1 a.142.1.1 * 1.8e-25 33.9 %
:HMM:SCOP  176->279 1h99A2 a.142.1.1 * 9.1e-22 37.5 %
:RPS:PFM   10->57 PF03123 * CAT_RBD 4e-10 50.0 %
:RPS:PFM   82->169 PF00874 * PRD 3e-14 42.0 %
:RPS:PFM   206->274 PF00874 * PRD 3e-14 47.8 %
:HMM:PFM   82->170 PF00874 * PRD 3.3e-23 39.3 89/90  
:HMM:PFM   190->276 PF00874 * PRD 6.6e-24 40.7 86/90  
:HMM:PFM   9->58 PF03123 * CAT_RBD 5.2e-17 42.0 50/59  
:BLT:SWISS 10->276 SACY_BACSU 1e-39 32.3 %
:REPEAT 2|77->174|185->281

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48881.1 GT:GENE ABO48881.1 GT:PRODUCT transcriptional antiterminator, BglG GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(347939..348787) GB:FROM 347939 GB:TO 348787 GB:DIRECTION - GB:PRODUCT transcriptional antiterminator, BglG GB:NOTE PFAM: CAT RNA-binding domain protein; PRD domain protein KEGG: bld:BLi01597 transcriptional antiterminator essential for the expression of the ptsGHI operon; RBL02128 GB:PROTEIN_ID ABO48881.1 GB:DB_XREF GI:134050910 InterPro:IPR004341 InterPro:IPR011608 LENGTH 282 SQ:AASEQ MQTPHGPFTIQRVLSNNAVIAHTPKGQDVILLGKGMGFGRKSGDILSNPKYEKIYVVPEGVTDQKALALMEQVDPAVINVTQNIIELAKAQLGEGLHPRVHVALADHINFTLIRLAQGMEIKNPFLAEIEAMYPKEFSIAKQGAVLILEKMNIFIPPEEIGFIALHLHSARHNRHVSQSLKHAEVINRAVKYIESQFGPIKEHGGLEYTRLLSHLQSCIHRLVNKTTIENPFLDKLKQEFSNSYEIARQMSNILEEGLGIPVPEDEIGYLAMHIERIRRNKT GT:EXON 1|1-282:0| BL:SWS:NREP 1 BL:SWS:REP 10->276|SACY_BACSU|1e-39|32.3|266/280| NREPEAT 1 REPEAT 2|77->174|185->281| BL:PDB:NREP 2 BL:PDB:REP 10->56|1auuA|2e-05|37.0|46/55| BL:PDB:REP 64->277|1h99A|6e-31|31.3|214/220| RP:PDB:NREP 1 RP:PDB:REP 10->57|1auuA|1e-09|36.2|47/55| RP:PFM:NREP 3 RP:PFM:REP 10->57|PF03123|4e-10|50.0|48/58|CAT_RBD| RP:PFM:REP 82->169|PF00874|3e-14|42.0|88/90|PRD| RP:PFM:REP 206->274|PF00874|3e-14|47.8|69/90|PRD| HM:PFM:NREP 3 HM:PFM:REP 82->170|PF00874|3.3e-23|39.3|89/90|PRD| HM:PFM:REP 190->276|PF00874|6.6e-24|40.7|86/90|PRD| HM:PFM:REP 9->58|PF03123|5.2e-17|42.0|50/59|CAT_RBD| GO:PFM:NREP 4 GO:PFM GO:0003723|"GO:RNA binding"|PF03123|IPR004341| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF03123|IPR004341| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00874|IPR011608| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00874|IPR011608| RP:SCP:NREP 3 RP:SCP:REP 10->56|1auuA|3e-10|37.0|46/55|b.35.2.1| RP:SCP:REP 69->173|1h99A1|3e-20|39.0|105/115|a.142.1.1| RP:SCP:REP 176->279|1h99A2|5e-15|24.0|104/105|a.142.1.1| HM:SCP:REP 8->62|1l1cA_|9.9e-13|45.5|55/0|b.35.2.1|1/1|SacY-like RNA-binding domain| HM:SCP:REP 61->175|1h99A1|1.8e-25|33.9|115/115|a.142.1.1|1/2|PTS-regulatory domain, PRD| HM:SCP:REP 176->279|1h99A2|9.1e-22|37.5|104/107|a.142.1.1|2/2|PTS-regulatory domain, PRD| OP:NHOMO 458 OP:NHOMOORG 198 OP:PATTERN -------------------------------------------------------------------- -----11-112-1----------------------------------------11--------1-------1---111------------------------------------------------------------------------------------------------------------------34222223232222332647785323133-323345647311222222122222221111123--33--4-345--26--121-11-112321221133332232312111111111111122111-2223-3-576667557353-D--1211-----1-------1--1---642-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------132-2-1--2122211--1111221---2-11111112155111----------------111-1111--1--------------------------------1----------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 261 STR:RPRED 92.6 SQ:SECSTR #########EcccccccEEEEEc#cccEEEEEcTTccTTccTTccccTTTccEEEEc######GGGTcccccccHHHHHHHHHHHHHHHHHHcccccTHHHHHHHHHHHHHHHHHHTTcccccTTHHHHHHHTHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHTccccTTcHHHHHHHHHHHHHHHHHHHTcccccTHHHHHHHHTHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHH##### DISOP:02AL 1-5,8-8,280-283| PSIPRED cccccccEEEEEEEccEEEEEEEccccEEEEEEccccccccccccccHHHcEEEEEEcccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHcHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccc //