[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48885.1
DDBJ      :             stress protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  97/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
d.209.1
:200 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   15->199 3ibzA PDBj 6e-43 48.5 %
:RPS:PDB   1->183 2a5iA PDBj 6e-37 14.5 %
:RPS:SCOP  49->139 1jbiA  d.209.1.1 * 3e-18 13.8 %
:RPS:PFM   71->185 PF02342 * TerD 2e-36 53.9 %
:HMM:PFM   72->194 PF02342 * TerD 2.3e-41 41.0 122/128  
:HMM:PFM   2->57 PF10138 * Tellurium_res 4.1e-08 30.9 55/99  
:BLT:SWISS 2->200 SCP2_BACSU 1e-64 66.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48885.1 GT:GENE ABO48885.1 GT:PRODUCT stress protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 351329..351931 GB:FROM 351329 GB:TO 351931 GB:DIRECTION + GB:PRODUCT stress protein GB:NOTE PFAM: stress protein KEGG: bld:BLi00354 YceC GB:PROTEIN_ID ABO48885.1 GB:DB_XREF GI:134050914 InterPro:IPR003325 LENGTH 200 SQ:AASEQ MINLQKGQKIDLTKTNPNLSKIMVGLGWDPVKSGGGGFLGGLFGGGSPNIDCDASVYLLNANGKLAKDKNLVYFGNKTSPCASVRHAGDNVTGQGDGDDEQIFIDLTQVPADVHRLVFVVNIYDCVARKQHFGMIQNAFIRVVNSANGQELCKFNLSEGYEGKTSLITGEVYRHNGEWKFAAIGEATTDPGLKSLTQRYL GT:EXON 1|1-200:0| BL:SWS:NREP 1 BL:SWS:REP 2->200|SCP2_BACSU|1e-64|66.0|197/199| SEG 34->46|ggggflgglfggg| BL:PDB:NREP 1 BL:PDB:REP 15->199|3ibzA|6e-43|48.5|171/176| RP:PDB:NREP 1 RP:PDB:REP 1->183|2a5iA|6e-37|14.5|166/306| RP:PFM:NREP 1 RP:PFM:REP 71->185|PF02342|2e-36|53.9|115/125|TerD| HM:PFM:NREP 2 HM:PFM:REP 72->194|PF02342|2.3e-41|41.0|122/128|TerD| HM:PFM:REP 2->57|PF10138|4.1e-08|30.9|55/99|Tellurium_res| GO:PFM:NREP 1 GO:PFM GO:0006950|"GO:response to stress"|PF02342|IPR003325| RP:SCP:NREP 1 RP:SCP:REP 49->139|1jbiA|3e-18|13.8|80/100|d.209.1.1| OP:NHOMO 352 OP:NHOMOORG 101 OP:PATTERN -------------------------------------------------------------------- ------------------------------------5443-5543-----------------1----9AA-----------------------------------3---2------------------------------------14--33-----------21----14--------------3-------3444443333343334--3343333---3---------4----------------------------------------------3----------------------------------------------32------------5114----4----------73-----------------------------------------------------------------------1--------------------------------3-------------------------------------------1-----------------42----------------5------1----------------4-----------------------------------------------------------------------5----------------------2----------5------36----5---3---------3---------44----4---------------------------44444444444------------------------------3--------4333----------------433----------------------------------------1-------------------------------------------------------- ----61------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 198 STR:RPRED 99.0 SQ:SECSTR EccccTTcEEEEEEEETTEEEEEccTTccccccccTTcTTcEEEEEEEEEETTEEEEEEEEEEEcEEcTTcccccccccccccccccccccccHHHHHHHHHHHHHTTccTTcccccccHHHHHHHHHTcccccHHHHHHTHHHHHHTccHHHHHHHHccTTcccTcHHHHHHHHTccTTcccEEEcTT#HHHHHHHHT# PSIPRED cEEEEcccEEEEccccccccEEEEEEEEcccccccccEEEHHcccccccccEEEEEEEEcccccccccccEEEcccccccccEEEEcccccccccccccEEEEEEHHcccccccEEEEEEEEEccccccccHHHccccEEEEEEccccEEEEEEEEcccccccEEEEEEEEEEEcccEEEEEEEcccccccHHHHHHHHc //