[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48893.1
DDBJ      :             Uncharacterized protein involved in stress response-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  71/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:232 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   27->78 3ibzA PDBj 7e-08 41.2 %
:RPS:PDB   135->210 2amdA PDBj 4e-05 10.0 %
:RPS:PFM   25->70 PF02342 * TerD 2e-09 45.7 %
:RPS:PFM   134->187 PF10138 * Tellurium_res 1e-07 52.0 %
:HMM:PFM   87->187 PF10138 * Tellurium_res 1.4e-35 46.9 98/99  
:HMM:PFM   26->71 PF02342 * TerD 1.2e-11 45.7 46/128  
:BLT:SWISS 16->78 CDRB_CLOAB 7e-17 54.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48893.1 GT:GENE ABO48893.1 GT:PRODUCT Uncharacterized protein involved in stress response-like protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 358583..359281 GB:FROM 358583 GB:TO 359281 GB:DIRECTION + GB:PRODUCT Uncharacterized protein involved in stress response-like protein GB:NOTE KEGG: aci:ACIAD1958 tellurium resistance protein GB:PROTEIN_ID ABO48893.1 GB:DB_XREF GI:134050922 LENGTH 232 SQ:AASEQ MDTSIHTSFQKLKRTVQDVRGMSYKHLIRFNMGRNFNAETAIVVAELYRYKGEWKFNPIAMGYQGGLAALCGSFGIDVSDNPTNQPAQAQAAPTIEREPQPKPVPPQPKINLSKIELKKKGEKINLEKKVNNRLGEILINLNWSRKPINQGGGGFFASIFGSGNKGIDLDLGCMIETKDGRKTVVQALDNDFGDLDFWPFVSLNPRNSFFVSRCKDVCMNEEAGKIKKANSS GT:EXON 1|1-232:0| BL:SWS:NREP 1 BL:SWS:REP 16->78|CDRB_CLOAB|7e-17|54.0|63/139| SEG 81->94|nptnqpaqaqaapt| SEG 99->109|pqpkpvppqpk| SEG 114->129|kielkkkgekinlekk| SEG 151->163|ggggffasifgsg| BL:PDB:NREP 1 BL:PDB:REP 27->78|3ibzA|7e-08|41.2|51/176| RP:PDB:NREP 1 RP:PDB:REP 135->210|2amdA|4e-05|10.0|70/309| RP:PFM:NREP 2 RP:PFM:REP 25->70|PF02342|2e-09|45.7|46/125|TerD| RP:PFM:REP 134->187|PF10138|1e-07|52.0|50/85|Tellurium_res| HM:PFM:NREP 2 HM:PFM:REP 87->187|PF10138|1.4e-35|46.9|98/99|Tellurium_res| HM:PFM:REP 26->71|PF02342|1.2e-11|45.7|46/128|TerD| GO:PFM:NREP 1 GO:PFM GO:0006950|"GO:response to stress"|PF02342|IPR003325| OP:NHOMO 119 OP:NHOMOORG 71 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------1----1-----------------------11-------------------------------------------------------------------------------------------------------------------1-------2333332222232223--2222222---2---------3---------------------------------------------------------------------------------------------21------------4113----3----------32----------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------1-----------------------1-----------------------------------------------------------------------1---------------------------------1------12----1---1---------1---------11----2---------------------------11111111111------------------------------2--------2111----------------111------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 128 STR:RPRED 55.2 SQ:SECSTR ##########################EEEEEHHHHcTTccE#EEEEEEEETTEEEEEEEEEEcTTHHHHHHHHTTccc#######################################################EEEEEEEccTTccccccccTTcTTcTTcTTcEEEEEETTEEEEcTTccEEEEcTTcccccccccccccccccccccc###################### DISOP:02AL 84-108,144-153,225-233| PSIPRED cccHHHHHHHHcccEEEEEEcccccEEEEEEcccccccEEEEEEEEEEEEcccEEEEEEEcccccHHHHHHHHHccEEccccccccHHHccccccccccccccccccccccEEEEEEEccccEEcHHHHHHccccEEEEEEEcccccccccccEEEEEEEccccccccEEEEEEEEEccccEEEEEEcccccccccccccEEEccccccHHHHHHHHHcccccccEEccccc //