Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48898.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:87 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48898.1 GT:GENE ABO48898.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(369058..369321) GB:FROM 369058 GB:TO 369321 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO48898.1 GB:DB_XREF GI:134050927 LENGTH 87 SQ:AASEQ MVGGGVANQRLRLILQIMVAQWISTCTLVVYPPTSHGVQYMALTFLRSTSQGVEARYAPLLGHARMEILVPGFSVLRLSIQFIVNKC GT:EXON 1|1-87:0| OP:NHOMO 7 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------7--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,6-7| PSIPRED cccccccHHHHHHHHHHHHHHHHHHcEEEEEccccccHHHHHHHHHHHHccccHHHHHHHHcccEEEEEcccHHHHHHHHEEEEEcc //