[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48917.1
DDBJ      :             FAD linked oxidase domain protein
Swiss-Prot:             

Homologs  Archaea  42/68 : Bacteria  664/915 : Eukaryota  189/199 : Viruses  0/175   --->[See Alignment]
d.145.1d.58.32
:468 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   47->260 2uuuC PDBj 2e-26 29.3 %
:RPS:PDB   3->467 1e8gA PDBj 2e-81 19.9 %
:RPS:SCOP  10->223 1ahuA2  d.145.1.1 * 2e-46 30.4 %
:RPS:SCOP  224->467 1f0xA1  d.58.32.2 * 2e-41 13.5 %
:HMM:SCOP  7->223 1f0xA2 d.145.1.1 * 2.4e-72 49.1 %
:HMM:SCOP  186->468 1e8gA1 d.58.32.1 * 1.4e-63 39.4 %
:RPS:PFM   48->186 PF01565 * FAD_binding_4 1e-28 44.9 %
:RPS:PFM   223->465 PF02913 * FAD-oxidase_C 1e-40 35.3 %
:HMM:PFM   222->466 PF02913 * FAD-oxidase_C 3e-62 30.7 244/249  
:HMM:PFM   47->186 PF01565 * FAD_binding_4 2.1e-43 42.0 138/138  
:BLT:SWISS 6->466 GLCD_BACSU 4e-85 37.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48917.1 GT:GENE ABO48917.1 GT:PRODUCT FAD linked oxidase domain protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 390865..392271 GB:FROM 390865 GB:TO 392271 GB:DIRECTION + GB:PRODUCT FAD linked oxidase domain protein GB:NOTE PFAM: FAD linked oxidase domain protein KEGG: tte:TTE0224 FAD/FMN-containing dehydrogenases GB:PROTEIN_ID ABO48917.1 GB:DB_XREF GI:134050946 InterPro:IPR004113 InterPro:IPR006094 LENGTH 468 SQ:AASEQ MQFNKVTDGIVQELKAILGEGNVLIEEEKLDMYSRDEVSDKLWEKMPEVVVKPENVEQVSEIVKLANRELLPITPRGGGTGLAAGAVPLSGGLVLSLEKMNKILEVDTENLFMVVEPGVTTGEVQKTAKAQGLLYAGDPCSADSSFIGGNVATNAGGNKAVKYGVTSRHIYGLEVVMPNGDIVTFGGKNVKDVTGYDFVHLMVGSEGTLGVVTKIWLKLMPLPKYVADLLVPFADMQSAIQVVPKIMTAGIIPTCLEFMDSLSIKAAEMYLNKKLPYSDAGAYIICEIDGTSETQVQDDYETIGKVCQDNGALEVFVADNMSTQERIWKSRKCYAEAIRMLSPVYCMEDVVVPVSNIPKALEAIERIAKKYECKIPSCGHAGDGNIHATVLREDRDDHEWHDLKDKVLEELYEEVYQLGGNLSGEHGIGAKRAGAMDKHMTEAQLNVLRSIKKALDPKGIMNPGKVLV GT:EXON 1|1-468:0| BL:SWS:NREP 1 BL:SWS:REP 6->466|GLCD_BACSU|4e-85|37.7|456/470| SEG 402->416|dlkdkvleelyeevy| BL:PDB:NREP 1 BL:PDB:REP 47->260|2uuuC|2e-26|29.3|208/541| RP:PDB:NREP 1 RP:PDB:REP 3->467|1e8gA|2e-81|19.9|463/550| RP:PFM:NREP 2 RP:PFM:REP 48->186|PF01565|1e-28|44.9|138/139|FAD_binding_4| RP:PFM:REP 223->465|PF02913|1e-40|35.3|241/242|FAD-oxidase_C| HM:PFM:NREP 2 HM:PFM:REP 222->466|PF02913|3e-62|30.7|244/249|FAD-oxidase_C| HM:PFM:REP 47->186|PF01565|2.1e-43|42.0|138/138|FAD_binding_4| GO:PFM:NREP 4 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01565|IPR006094| GO:PFM GO:0050660|"GO:FAD binding"|PF01565|IPR006094| GO:PFM GO:0003824|"GO:catalytic activity"|PF02913|IPR004113| GO:PFM GO:0050660|"GO:FAD binding"|PF02913|IPR004113| RP:SCP:NREP 2 RP:SCP:REP 10->223|1ahuA2|2e-46|30.4|214/268|d.145.1.1| RP:SCP:REP 224->467|1f0xA1|2e-41|13.5|223/237|d.58.32.2| HM:SCP:REP 7->223|1f0xA2|2.4e-72|49.1|212/0|d.145.1.1|1/1|FAD-binding domain| HM:SCP:REP 186->468|1e8gA1|1.4e-63|39.4|236/0|d.58.32.1|1/1|FAD-linked oxidases, C-terminal domain| OP:NHOMO 2806 OP:NHOMOORG 895 OP:PATTERN 22-1-143345444441133321331111122----------------13221----1--12113--1 125551-1111-2-33344-432256545553333338D7145321121111143212--33524684531--------1-141111111---1-------211111212---------------2222222221266655---232432443222222122323233232-1---111--1-22233--131122222222223222353111122234413--------21-----------------------1111----11--21------------------------------------------------------4-121111111212-122211131-1-1--2-461121--52--1--1-322311411111349663256675544444443446-56655B5A5741744647A668977532155554674552222222243322335-----------------------------21871176666977A7A6555588CB655545B7A8A89245558765597966A556422125222222254386616824345453555-354132222565646232--112211212222222211111133211-41213122222212322222223233---6344------21111113213334333-233344334323433333112111121111111111111111121121111--111111111111---1--111122232544111111-111111111111111352516666575445557434431212311111112222221122222222222232222112-221122--------1-1--------------------------11---2---421 ----332-741-2424475574567643333334444534444233674478D84334344423324334225243313334446312-47444433332332534-334733353331-2332972538K5-4351311322621323241143452569434322425335352333Y3322131175313386642 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 468 STR:RPRED 100.0 SQ:SECSTR THcHHHHHHHHHHHHHHHcGGGEEEcccccccccccccccccccccccEEEccccHHHHHHHHHHHHHHTccEEEEcccccTTTTTTccTTcEEEEcTTcccEEEEETTTTEEEEcTTccHHHHHHHHHHTTcTTTEEccccccTTccHHHHHHTTcccccTTccTGGGEEEEEEEETTccEEEcGGGGGGGccccTTTTTGGGcccccEEEEEEEEEcEEccccEEEEEEEEccTTHHHHHHHHHHHHHTccccccEEEEHHHHHHHHccGGGTcccccccccHHHHHHHHHHHHTcccEEEEEEEEcccTTcEEEcGGGccTTcHHHHHHHHTTTccccEEEEEccEEcccHHHHHHHHHHHHHHHHHHTccccEEEEEccccEEEEEEEEETTcHHHHHHHHHHHHHHHHHHHHTTcccccccGGGHHHHHHHTcHHHHHHHHHHHHHHHHHcTTccccTTGGGc DISOP:02AL 1-6| PSIPRED cccccccHHHHHHHHHHcccccEEccHHHHHHHHccccccccccccccEEEEcccHHHHHHHHHHHHHcccEEEEEccccccccccccccccEEEEccccccEEEEEccccEEEEEccccHHHHHHHHHHcccEEccccccccccccccccccccccccccccccHHHEEEEEEEEcccccEEEcccHHcccccccHHHHHHHccccccEEEEEEEEEEEEccccEEEEEEEEccHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHccccccccccEEEEEEEccccHHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccHHHHHHHHHHHHHHHHHccccEEEEEEcccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHccHHHHHHHHHHHHHHccccccccccccc //