[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48921.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:153 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   12->62 PF11801 * Tom37_C 0.00019 13.3 45/168  
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48921.1 GT:GENE ABO48921.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(395748..396209) GB:FROM 395748 GB:TO 396209 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO48921.1 GB:DB_XREF GI:134050950 LENGTH 153 SQ:AASEQ MLNSYFRKPFYTNIPKTAEERKQEQEQKIQEAKLRAEQQNTQFLERYQDFVDTFNCLYPDIKHKYIIEKVMAGYGLYPFIYINLKNLTNKKETKFHLNHETNQWHITRNNCLWDDSKYEILEPLTTKDQMDTIIEELNKELIINHDQYRTLKP GT:EXON 1|1-153:0| COIL:NAA 24 COIL:NSEG 1 COIL:REGION 22->45| SEG 16->33|ktaeerkqeqeqkiqeak| SEG 83->94|nlknltnkketk| SEG 133->144|iieelnkeliin| HM:PFM:NREP 1 HM:PFM:REP 12->62|PF11801|0.00019|13.3|45/168|Tom37_C| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,15-39,151-154| PSIPRED ccHHHHHccHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccEEEEEHHHccccHHHEEEccccccEEEEEccccccccccHHHHcccccHHHHHHHHHHHHHHHHccHHHHccccc //