[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48922.1
DDBJ      :             phage portal protein, SPP1
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:440 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   213->430 2jesA PDBj 1e-10 27.2 %
:RPS:PDB   87->184 3bnbA PDBj 2e-04 25.0 %
:RPS:PFM   37->430 PF05133 * Phage_prot_Gp6 4e-34 29.0 %
:HMM:PFM   27->432 PF05133 * Phage_prot_Gp6 2.5e-70 24.2 401/442  
:BLT:SWISS 284->424 THSB_SULSH 2e-04 28.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48922.1 GT:GENE ABO48922.1 GT:PRODUCT phage portal protein, SPP1 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(397103..398425) GB:FROM 397103 GB:TO 398425 GB:DIRECTION - GB:PRODUCT phage portal protein, SPP1 GB:NOTE PFAM: phage portal protein, SPP1 KEGG: swo:Swol_1309 hypothetical protein GB:PROTEIN_ID ABO48922.1 GB:DB_XREF GI:134050951 InterPro:IPR006428 LENGTH 440 SQ:AASEQ MNLQEYINVVHDGKPDWFVSECNSYYHQSRINNIIDIKEYLSGSHLINNRPAEMWNGKVFEPRRIVLQYAKTVLNFSTSYLLKNPVTITGEENDVKVMKKVYKQGKFNRTDLDIMDKLVKYGAIYEYIFVDKDGKIKSKLINPEDAYPIYNEQGEMICFIEHYTTDYNVSYYNIFTDSTVQKWSDAGGDFNFLGVFNNPSGLPCVYKNLNELDNTDGRSDLEDFINIIDNMEDLISKYTDSIYKFLNPIPVVIGQRLNIKDGKGEIPTNLVGVGLNLDDGADMKFIHGQLDFESFESVWKVLKQSLLDISNTPAVSMNNTDISNLSEVSIKLLFSLADIKAGLNERYIREGFEQRFKKIEKLLRLQGIEINSDNIDVVFQYARPLNETDIIDNIKVLKELGVMSLQSAIENCPMIYDVGSEMERLGKERNGLDNTDIVNS GT:EXON 1|1-440:0| BL:SWS:NREP 1 BL:SWS:REP 284->424|THSB_SULSH|2e-04|28.2|131/552| BL:PDB:NREP 1 BL:PDB:REP 213->430|2jesA|1e-10|27.2|206/370| RP:PDB:NREP 1 RP:PDB:REP 87->184|3bnbA|2e-04|25.0|88/818| RP:PFM:NREP 1 RP:PFM:REP 37->430|PF05133|4e-34|29.0|390/428|Phage_prot_Gp6| HM:PFM:NREP 1 HM:PFM:REP 27->432|PF05133|2.5e-70|24.2|401/442|Phage_prot_Gp6| OP:NHOMO 23 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-----1-------1--1-----------1-------------------------------------------11-----1---------------------------------------1--1-----1-1---211-----1-1---------2-1-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 297 STR:RPRED 67.5 SQ:SECSTR ######################################################################################HcTTGGGHHHHHHHHHTTccGGGGcHH##HHHHHTT######cEEEcTTcTTcEEEcccccHHHHHHHHHHHHHHHHHHHHGGGTcc##cHHHHHTcH############################cccccccGGGGTHHHHHHHHHHHHHHHHHHHHTTccEEE#######EEEEccccHHHHHHccEEEEEEEEEEcccccHHHHHHHHHHHHHHHHTTccccccT##cccccTTTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccccHHHcEEEccccccccHHHHHHHHHHHHHHTcccHHHHHHHcTTcccHHHHHHHHHHHHT########## DISOP:02AL 1-3,274-274,276-276,317-327,435-435,440-441| PSIPRED ccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHccccccccccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHEEEcccccEEEEEEccccEEEEEEccccEEEEEEEEEccccEEEEEEEccccEEEEEccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccccccEEEEEccccHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEcccccccHHHHHHHHHHHHHcccccHHHHHHHccccccHHHHHHHHHHHHccccHHHHHcc //