[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48926.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:277 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48926.1 GT:GENE ABO48926.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(402784..403617) GB:FROM 402784 GB:TO 403617 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: swo:Swol_1313 hypothetical protein GB:PROTEIN_ID ABO48926.1 GB:DB_XREF GI:134050955 LENGTH 277 SQ:AASEQ MKSNIKEMFPVWVNDNKYYDLILSNDLDSFFSCQLLEMIKGWKVNFFNSDFKALGITENASNESDVIGVDLSLCSGKTFDNHVVMMNQDDDYNYNSANFNIIDRISRENYFSKYCGSTLLTIWSLYNIPLPKSEEAKMILLCIDSTFKGFYSPYPMPKEANKKYLVDYMDFPELYECLQRHKQYEFLNLISKYNLAGKIKPKQGYLHTDINLKALREVFDLPFLLPKNRFYKKEEYETYVNRLPRNDYRLVKDDISECMYSIALTNRDFISYSERIE GT:EXON 1|1-277:0| OP:NHOMO 9 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-------------1---------------------------------------------------------------------------------------------------------2----------1-----------------------2-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,277-278| PSIPRED ccccHHHcccEEEcccEEEEEEEEcccHHHHHHHHHHHHcccEEEEEccccEEEEEcccccccccEEEEEEEEEcccccccEEEEEEcccccccccccEEHEEHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEcccHHHccccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccEEcccccEEEccccHHHHHHHHccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccHHHHcc //