[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48965.1
DDBJ      :             putative transcriptional regulator, MerR family
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  51/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.6.1
:146 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->64 1r8eA PDBj 8e-10 46.0 %
:RPS:PDB   1->113 3d70A PDBj 6e-17 31.8 %
:RPS:SCOP  2->108 1jbgA  a.6.1.3 * 1e-14 25.7 %
:HMM:SCOP  1->118 1jbgA_ a.6.1.3 * 2.2e-21 38.1 %
:RPS:PFM   4->39 PF00376 * MerR 2e-07 58.3 %
:HMM:PFM   3->39 PF00376 * MerR 1.3e-16 51.4 37/38  
:HMM:PFM   52->122 PF06160 * EzrA 2e-05 18.3 71/559  
:BLT:SWISS 2->107 CUER_BACSU 2e-18 46.6 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48965.1 GT:GENE ABO48965.1 GT:PRODUCT putative transcriptional regulator, MerR family GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 459037..459477 GB:FROM 459037 GB:TO 459477 GB:DIRECTION + GB:PRODUCT putative transcriptional regulator, MerR family GB:NOTE PFAM: regulatory protein, MerR KEGG: bld:BLi01027 YhdQ GB:PROTEIN_ID ABO48965.1 GB:DB_XREF GI:134050994 InterPro:IPR000551 LENGTH 146 SQ:AASEQ MYRIGQFAKLAGVSRRTVDYYTKLGLLEPVRSESNYRYYNQDALIRLKLIEMLKSQRLTLEEIKGQIEYISNVMNSDKKKYSQRAIDIQYLKDQFKVLETQLGQLQPMVTNMEAGQAAAMTKQVLIQSMTIIQSLLLYINEAALFL GT:EXON 1|1-146:0| BL:SWS:NREP 1 BL:SWS:REP 2->107|CUER_BACSU|2e-18|46.6|103/143| TM:NTM 1 TM:REGION 124->146| BL:PDB:NREP 1 BL:PDB:REP 2->64|1r8eA|8e-10|46.0|63/275| RP:PDB:NREP 1 RP:PDB:REP 1->113|3d70A|6e-17|31.8|110/276| RP:PFM:NREP 1 RP:PFM:REP 4->39|PF00376|2e-07|58.3|36/37|MerR| HM:PFM:NREP 2 HM:PFM:REP 3->39|PF00376|1.3e-16|51.4|37/38|MerR| HM:PFM:REP 52->122|PF06160|2e-05|18.3|71/559|EzrA| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00376|IPR000551| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00376|IPR000551| RP:SCP:NREP 1 RP:SCP:REP 2->108|1jbgA|1e-14|25.7|101/106|a.6.1.3| HM:SCP:REP 1->118|1jbgA_|2.2e-21|38.1|105/106|a.6.1.3|1/1|Putative DNA-binding domain| OP:NHOMO 72 OP:NHOMOORG 52 OP:PATTERN ---------------------------------------------1---------------------- -2-----------------------------------------------------------1--------------------------------------------------------------------------------------------1----------11-------------------------112222221312222221-11112211----1-------321--1-1-1------------------------------------------------1--11-----1-------------1------------------11--1--1-------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------11----------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 113 STR:RPRED 77.4 SQ:SECSTR cEEHHHHHHHHTccHHHHHHHHHTTccccEcTTTccEEEcGGGGGHHHHHHHHHHHTccHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH################################# PSIPRED cccHHHHHHHHcccHHHHHHHHHcccccccccccccEEccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHc //