[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48970.1
DDBJ      :             protein of unknown function DUF81
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:323 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   17->119 PF01925 * TauE 7e-06 27.5 %
:RPS:PFM   222->310 PF01925 * TauE 4e-04 24.7 %
:HMM:PFM   17->315 PF01925 * TauE 6.9e-40 30.0 233/239  
:BLT:SWISS 83->193 OPT2_YEAST 7e-04 31.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48970.1 GT:GENE ABO48970.1 GT:PRODUCT protein of unknown function DUF81 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 463976..464947 GB:FROM 463976 GB:TO 464947 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF81 GB:NOTE PFAM: protein of unknown function DUF81 KEGG: dvl:Dvul_2200 protein of unknown function DUF81 GB:PROTEIN_ID ABO48970.1 GB:DB_XREF GI:134050999 InterPro:IPR002781 LENGTH 323 SQ:AASEQ MHFPVSGVDVLPFIPPLVAFLVSSLTASAGVSGAFLLLPFQMSVLHYTSPSVSPTNLIYNIIAIPGGLYRYIKEGRMAWPLTWAVVVGTLPGVFFGAWVRIKYLPDPGSFKLFVGFVLMYLGYRLLSEVMGWNKKVKEQNKFMQKKFSEQIAKLKEENNHRMAAGLPPEAVVKTKKVSLKKIEYDFWGETYSFGTMSILGLALVVGLIGGIYGIGGGAIISPFCVAVLGLPVYTVAGAALAGTFITSIAGVVYYHILATTHLASNAVVTPDWLLGALFGVGGLLGTYVGARIQKFLPDRFIKGILCLLVLFLAFNYIIQYFWK GT:EXON 1|1-323:0| BL:SWS:NREP 1 BL:SWS:REP 83->193|OPT2_YEAST|7e-04|31.1|106/877| TM:NTM 6 TM:REGION 13->35| TM:REGION 193->215| TM:REGION 217->239| TM:REGION 241->263| TM:REGION 269->291| TM:REGION 300->322| SEG 198->220|ilglalvvgliggiygigggaii| SEG 273->285|llgalfgvggllg| RP:PFM:NREP 2 RP:PFM:REP 17->119|PF01925|7e-06|27.5|102/237|TauE| RP:PFM:REP 222->310|PF01925|4e-04|24.7|79/237|TauE| HM:PFM:NREP 1 HM:PFM:REP 17->315|PF01925|6.9e-40|30.0|233/239|TauE| GO:PFM:NREP 2 GO:PFM GO:0016021|"GO:integral to membrane"|PF01925|IPR002781| GO:PFM GO:0016021|"GO:integral to membrane"|PF01925|IPR002781| OP:NHOMO 24 OP:NHOMOORG 21 OP:PATTERN -----------------------1-------------------------------------------- -----------------------------------------1---------------------------1------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-221-------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------211-11-11-1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,135-163| PSIPRED cccccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHEEcccccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHcccccccccEEEEEEEEEEEEEEccEEEEcHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcc //