[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48974.1
DDBJ      :             Integral membrane protein TerC
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  142/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:225 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   25->182 PF03741 * TerC 3e-12 27.4 %
:HMM:PFM   14->183 PF03741 * TerC 2.5e-44 32.5 169/184  
:BLT:SWISS 26->190 YJBE_BACSU 7e-37 41.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48974.1 GT:GENE ABO48974.1 GT:PRODUCT Integral membrane protein TerC GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(468771..469448) GB:FROM 468771 GB:TO 469448 GB:DIRECTION - GB:PRODUCT Integral membrane protein TerC GB:NOTE PFAM: Integral membrane protein TerC KEGG: gka:GK0610 hypothetical protein GB:PROTEIN_ID ABO48974.1 GB:DB_XREF GI:134051003 InterPro:IPR005496 LENGTH 225 SQ:AASEQ MEFLTADFLSALLVIVLIDLVLAGDNAIVIGMAARNVPKEHQRQVILWGTAGAIMIRILATLAVVWLLEIPGLMLVGGLLLVWIAYKLLTEEKSHDQIRACDNRWEAIRTIIIADAVMGLDNVLAIAGTAHGSFLLVVSGLLISVPIVVWGSTLLLKWVDRFPVIIYLGAGVIALTAAKMMLHEPMISSFFTNAPLLKYTVMVVVTGGVLLYGKMKKKKHNPLTC GT:EXON 1|1-225:0| BL:SWS:NREP 1 BL:SWS:REP 26->190|YJBE_BACSU|7e-37|41.8|165/218| TM:NTM 7 TM:REGION 8->30| TM:REGION 44->66| TM:REGION 70->92| TM:REGION 106->128| TM:REGION 133->155| TM:REGION 161->183| TM:REGION 191->213| SEG 12->22|llvivlidlvl| SEG 72->82|glmlvgglllv| SEG 199->212|ytvmvvvtggvlly| RP:PFM:NREP 1 RP:PFM:REP 25->182|PF03741|3e-12|27.4|157/178|TerC| HM:PFM:NREP 1 HM:PFM:REP 14->183|PF03741|2.5e-44|32.5|169/184|TerC| GO:PFM:NREP 1 GO:PFM GO:0016021|"GO:integral to membrane"|PF03741|IPR005496| OP:NHOMO 219 OP:NHOMOORG 143 OP:PATTERN -------------------------------------------------------------------- --1-------------------------------------------------------------------------------2-----------------------------------------------------------------------1-------------------------------------11222222221222222-1-111221233-1--------43---------------------------------------------------------------------------------------------1-------------11------------4-22-1-----------------11-------1211-1222111--------------------11---11-1111111123-------------11111111------1------------------------------1-----2443411111111111111211111111222221122211222223231331-------------1111-1-------------------------------2-----------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------------1111-------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 89-104,219-226| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccHHHHHEHHcccccccccc //