[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48983.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  72/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:312 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   41->308 3hn0B PDBj 4e-26 33.7 %
:RPS:PDB   50->250 2b65A PDBj 2e-11 15.5 %
:RPS:SCOP  47->195 1us4A  c.94.1.1 * 1e-08 14.8 %
:HMM:SCOP  23->309 2czlA1 c.94.1.1 * 3.4e-20 20.6 %
:RPS:PFM   58->290 PF02621 * DUF178 2e-06 24.3 %
:HMM:PFM   51->246 PF09084 * NMT1 1.3e-13 17.8 191/216  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48983.1 GT:GENE ABO48983.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 480907..481845 GB:FROM 480907 GB:TO 481845 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: dsy:DSY2736 hypothetical protein GB:PROTEIN_ID ABO48983.1 GB:DB_XREF GI:134051012 LENGTH 312 SQ:AASEQ MSFVAGCGNASQNTSTQEQLPEKIIIQAPPAPPTASLLKMVNSKPFGDQVQIELILYKTVEEATARVIKGEADFTILPVNTAAKLYNKGIDISLDSVTTWGILYLLSSEDAISKWQDLKGKEVYVGAQGASPDIITRYLMKKNNVSSSDVDLKYANSPEIAQMLIQGMIKTAVLPEPMVTQVLSRNKSVRIKLDFQREWQSVEKTSGLPQAGLVVKNKFIKEYPFAWANFRKSYQQALEQTVADPNSVAALVEQKFQIPGQVFVKSMARTNLKFVSAEHARADVEHYLSKLLSFSPDMVGGKLPDEKFYLAK GT:EXON 1|1-312:0| SEG 24->35|iiiqappappta| BL:PDB:NREP 1 BL:PDB:REP 41->308|3hn0B|4e-26|33.7|249/277| RP:PDB:NREP 1 RP:PDB:REP 50->250|2b65A|2e-11|15.5|194/341| RP:PFM:NREP 1 RP:PFM:REP 58->290|PF02621|2e-06|24.3|214/253|DUF178| HM:PFM:NREP 1 HM:PFM:REP 51->246|PF09084|1.3e-13|17.8|191/216|NMT1| RP:SCP:NREP 1 RP:SCP:REP 47->195|1us4A|1e-08|14.8|149/298|c.94.1.1| HM:SCP:REP 23->309|2czlA1|3.4e-20|20.6|267/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 78 OP:NHOMOORG 72 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------1-----------11-------------1----------------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------11-11111111111-11111111----21---22-1-1-------------------------------11-12------------11-11-1--1---11----------1---2-2----------------------------------------------------------------------------------------------------1---------------11-----1--1----1-------------------1---------1-1-----------------11-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1---------------------------1111111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 268 STR:RPRED 85.9 SQ:SECSTR ########################################HHcccEccTTcEEEEEEccHHHHHHHHHHTcccEEEEcHHHHHHHHHTTcEEEEEEEEccEEEEEEETTcTTccGGGcTTcEEEEccTTcTTTTHHHHHHHHHHHTcccGGcTTccTTcGGGTTccccTTcccTTcccTTcTTcHHHHHHHHHHTcTTcEETTcccEEEEEHHHHHHTcTTccccTTTTTccGGGEEEEcTTccEEcGGGEGGGTTTcccEEEEccEEEEEcccccHHHHHHHHHHHHHHHcTTccccHTcccccGGG#### DISOP:02AL 7-23| PSIPRED ccEEEEcccccccccccccccEEEEEEcccccccccHHHHHHHHHHccccEEEEEEcccHHHHHHHHHcccEEEEEEcHHHHHHHHHccccEEEEEEcccccEEEEEcccccccHHHHcccEEEEEccccHHHHHHHHHHHHccccHHHEEEEEccHHHHHHHHHcccccEEEEccHHHHHHHHccccEEEEEEHHHHHHHHcccccccccEEEEcHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccEEEHHHHHHHHHHHHHHHHHcccccccccccccHHHccc //