[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48987.1
DDBJ      :             YbaK/prolyl-tRNA synthetase associated region
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  228/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.116.1
:154 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->152 2z0kA PDBj 8e-24 39.0 %
:RPS:PDB   20->153 2cx5A PDBj 1e-30 38.8 %
:RPS:SCOP  5->152 1wdvA  d.116.1.1 * 4e-29 30.4 %
:HMM:SCOP  4->152 1wdvA_ d.116.1.1 * 2.7e-39 38.9 %
:RPS:PFM   23->126 PF04073 * YbaK 2e-19 45.2 %
:HMM:PFM   25->140 PF04073 * YbaK 1.3e-36 36.2 116/123  
:BLT:SWISS 1->139 YWHH_BACSU 3e-25 40.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48987.1 GT:GENE ABO48987.1 GT:PRODUCT YbaK/prolyl-tRNA synthetase associated region GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 483937..484401 GB:FROM 483937 GB:TO 484401 GB:DIRECTION + GB:PRODUCT YbaK/prolyl-tRNA synthetase associated region GB:NOTE PFAM: YbaK/prolyl-tRNA synthetase associated region KEGG: swo:Swol_2044 YbaK/EbsC family protein GB:PROTEIN_ID ABO48987.1 GB:DB_XREF GI:134051016 InterPro:IPR007214 LENGTH 154 SQ:AASEQ MPLNRVRNYVQKFDVGLQPIEFSDSTSTVEEAARVLGVEPGQIAKSILFRAKEHFGLFVTAGDVRVNLKKVKSLLGARPKMASAEEVEEVTGYRVGGVCPFALKQDLPIYLDESMRRFDVVYTAAGTPRSALPITFEQLQAVTRGNVVNVQEAE GT:EXON 1|1-154:0| BL:SWS:NREP 1 BL:SWS:REP 1->139|YWHH_BACSU|3e-25|40.3|139/157| BL:PDB:NREP 1 BL:PDB:REP 17->152|2z0kA|8e-24|39.0|136/156| RP:PDB:NREP 1 RP:PDB:REP 20->153|2cx5A|1e-30|38.8|134/157| RP:PFM:NREP 1 RP:PFM:REP 23->126|PF04073|2e-19|45.2|104/122|YbaK| HM:PFM:NREP 1 HM:PFM:REP 25->140|PF04073|1.3e-36|36.2|116/123|YbaK| RP:SCP:NREP 1 RP:SCP:REP 5->152|1wdvA|4e-29|30.4|148/150|d.116.1.1| HM:SCP:REP 4->152|1wdvA_|2.7e-39|38.9|149/0|d.116.1.1|1/1|YbaK/ProRS associated domain| OP:NHOMO 257 OP:NHOMOORG 235 OP:PATTERN ------------------1-11---------1------------------------------------ ---11---------1---------------------1-111----1-1------1--2--111----1111---------111--------------------------------------------------------------1----------------------------------------11--1--1--------1--------1111------1---------1----------------1-------1--1--------------11-----------------------------------------------121--1111-12----111----------1-1-11-111-11-221--1---------------111---1111211111111111---1--1-1-1--1111111111112-----11---1--122222222111-1-11-----------------------------1--1-1-11-1--1-1--1111--112222121-11111--11111111111111--1-1-11--------------1-------1--111-1-1-----------1--1--------------------------------------1111---1111-1--1---------------11---1-------------------------------11111--111111111111111111--------------------------1--1-1------1---------------11--1-------1121----1-------------------111-----11111-----------------1--------------1---------------------------------------- --------21---1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 149 STR:RPRED 96.8 SQ:SECSTR ####HHHHHHHHTTcccEEEEccTTcccHHHHHHHHTccGGGEEEEEEEEccccEEEEEEETTccccHHHHHHHHTcccEEccHHHHHHHHcccTTccccccccccccEEEEGGGGGcccEEEEcccTTEEEEEcHHHHHHHHccEEEccccc# DISOP:02AL 1-1,154-155| PSIPRED ccHHHHHHHHHHccccEEEEEcccccccHHHHHHHccccHHHEEEEEEEEEcccEEEEEEEcccEEcHHHHHHHHccccccccHHHHHHHHcccccccccccccccccEEEcHHHHccccEEEEcccccEEEEEcHHHHHHHHccEEEEEEccc //