[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49011.1
DDBJ      :             protein of unknown function DUF1232
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:85 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   37->61 PF06803 * DUF1232 2e-04 60.0 %
:HMM:PFM   32->63 PF06803 * DUF1232 1.5e-16 50.0 32/40  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49011.1 GT:GENE ABO49011.1 GT:PRODUCT protein of unknown function DUF1232 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(508371..508628) GB:FROM 508371 GB:TO 508628 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF1232 GB:NOTE PFAM: protein of unknown function DUF1232 GB:PROTEIN_ID ABO49011.1 GB:DB_XREF GI:134051040 InterPro:IPR010652 LENGTH 85 SQ:AASEQ MILMGDILKKIYFFIQGLLNPAVPKRFKYESGICFLYFLSPIDFVPDFIPLTGKADDMVVMFWGIKRIYDIIKIHKQFIKSKGTP GT:EXON 1|1-85:0| RP:PFM:NREP 1 RP:PFM:REP 37->61|PF06803|2e-04|60.0|25/40|DUF1232| HM:PFM:NREP 1 HM:PFM:REP 32->63|PF06803|1.5e-16|50.0|32/40|DUF1232| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,4-4,80-86| PSIPRED cHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //