[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49016.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:115 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->87 PF09225 * Endonuc-PvuII 2.3e-05 20.3 74/155  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49016.1 GT:GENE ABO49016.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 512409..512756 GB:FROM 512409 GB:TO 512756 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49016.1 GB:DB_XREF GI:134051045 LENGTH 115 SQ:AASEQ MVDLTSLITDDMETLGHMEFTVTNNDLFNKEIKEFTLFYKIVGESRIKLFRNQRMELIFVRLNDDWMRQGKIDISNATLPLAIQLKWDNKSVDELAVKTPGQQEYQSVTCLQIDN GT:EXON 1|1-115:0| HM:PFM:NREP 1 HM:PFM:REP 11->87|PF09225|2.3e-05|20.3|74/155|Endonuc-PvuII| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED cccHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEcHHHHHcccEEEccccEEEEEEEEEccccHHHHHcccccHHHHEEEEEEEEcc //