[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49024.1
DDBJ      :             anhydrase, family 3 protein
Swiss-Prot:             

Homologs  Archaea  45/68 : Bacteria  642/915 : Eukaryota  32/199 : Viruses  0/175   --->[See Alignment]
b.81.1
:170 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->170 1v3wA PDBj 5e-40 43.5 %
:RPS:PDB   1->165 2eg0A PDBj 2e-30 46.7 %
:RPS:SCOP  2->167 1xhdA  b.81.1.5 * 1e-29 45.8 %
:HMM:SCOP  1->169 1xhdA_ b.81.1.5 * 1e-47 34.9 %
:RPS:PFM   93->139 PF02595 * Gly_kinase 5e-04 36.2 %
:HMM:PFM   87->102 PF00132 * Hexapep 4.8e-05 50.0 16/18  
:BLT:SWISS 13->166 Y3753_PSEAE 1e-45 50.0 %
:REPEAT 2|85->102|103->120

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49024.1 GT:GENE ABO49024.1 GT:PRODUCT anhydrase, family 3 protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(521879..522391) GB:FROM 521879 GB:TO 522391 GB:DIRECTION - GB:PRODUCT anhydrase, family 3 protein GB:NOTE KEGG: pfl:PFL_1086 anhydrase, family 3 protein GB:PROTEIN_ID ABO49024.1 GB:DB_XREF GI:134051053 InterPro:IPR001451 LENGTH 170 SQ:AASEQ MILPYLEYSPHIHPSVYIAPTATVVGHVEIHEHASIWYNAVIRGDVDRISIGKKTNIQDGCMLHQDAGFPLLIGENVTVGHHTILHGCTIGDRCLIGMGAIILNGAYIGSESLIGAGTLVKEGQEIPPGVLAVGSPARVVRKLTEEEKQKLSQSAQHYFNMAEKHSISQK GT:EXON 1|1-170:0| BL:SWS:NREP 1 BL:SWS:REP 13->166|Y3753_PSEAE|1e-45|50.0|154/174| NREPEAT 1 REPEAT 2|85->102|103->120| BL:PDB:NREP 1 BL:PDB:REP 10->170|1v3wA|5e-40|43.5|161/173| RP:PDB:NREP 1 RP:PDB:REP 1->165|2eg0A|2e-30|46.7|165/170| RP:PFM:NREP 1 RP:PFM:REP 93->139|PF02595|5e-04|36.2|47/376|Gly_kinase| HM:PFM:NREP 1 HM:PFM:REP 87->102|PF00132|4.8e-05|50.0|16/18|Hexapep| GO:PFM:NREP 2 GO:PFM GO:0008887|"GO:glycerate kinase activity"|PF02595|IPR004381| GO:PFM GO:0031388|"GO:organic acid phosphorylation"|PF02595|IPR004381| RP:SCP:NREP 1 RP:SCP:REP 2->167|1xhdA|1e-29|45.8|166/172|b.81.1.5| HM:SCP:REP 1->169|1xhdA_|1e-47|34.9|169/0|b.81.1.5|1/1|Trimeric LpxA-like enzymes| OP:NHOMO 1067 OP:NHOMOORG 719 OP:PATTERN ------1111111111-1------1--1---1111-1111111111112132211111111122---- 11-1111111111111111-11--11111111-1111222-112-21--111111111----2-1211111---------2121111133111111---1121-111111---------------11111111111---11---213222221221111111121222212------------11111111-111111111111111111211111112321121------131-------------------1------1---------------111-------1--11111111111-------------1-111111111111411111112111122-111-1-----11-21-11--13-11211-12-11111-----111111111111211111111111-11111312122-111111111111121111111122111--------111-12111111111111--1-11-11-11--1111111121-111112223222111111231111113221312111213321121212111321-111111111111-32212121----------1111111--111131211-1-111111----------1111111222221212121111111211111122122----111------31111113222322233-2333222323222223223223111122122112111222222311222221-1-1111111111---1-11-1111113322---------------3333323111223333443324334233311111111111311111112111211111111112222--11222222--------------------------------------211------12 ----22--422----------------------------------------------------------------1-----------1--1-----------------42-----------------------------------------------------1---------1-2331Y---335477-524432224 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 170 STR:RPRED 100.0 SQ:SECSTR cEEccTTcccEEcTTcEEcTTcEEEEEEEEcTTcEEcTTcEEEEEEEEEEEccccEEcTTcEEEccTTccEEEcTTcEEccccEEEccEEcTTcEEcTTcEEcTTcEEcTTcEEcTTcEEcTTcEEcTTEEEEETTEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHcc DISOP:02AL 167-171| PSIPRED ccccccccccEEccccEEccccEEEccEEEccccEEccccEEEccccEEEEccccEEccccEEEccccccEEEcccEEEccccEEEccEEccccEEccccEEccccEEccccEEccccEEEccEEEccccEEEEcccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHcc //