[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49029.1
DDBJ      :             protein of unknown function DUF1540
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:128 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->50 PF07561 * DUF1540 1.9e-15 47.5 40/40  
:HMM:PFM   86->125 PF07561 * DUF1540 2.4e-17 52.5 40/40  
:PROS 1->112|PS00430|TONB_DEPENDENT_REC_1
:REPEAT 2|4->53|83->128

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49029.1 GT:GENE ABO49029.1 GT:PRODUCT protein of unknown function DUF1540 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(525291..525677) GB:FROM 525291 GB:TO 525677 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF1540 GB:NOTE PFAM: protein of unknown function DUF1540 KEGG: mta:Moth_1117 protein of unknown function DUF1540 GB:PROTEIN_ID ABO49029.1 GB:DB_XREF GI:134051058 InterPro:IPR010916 InterPro:IPR011437 LENGTH 128 SQ:AASEQ MHKSPRVLCEVNTCTHWLLGNLCTAANIDILYEEEGKMAQKDAHTECKTFYKKNGITSYLGSMDNVNWGGLVSGSFREGQQITPAVVCIVESCKYWAKGNLCEAETIQVSGQNANECQDTNCKTFEEK GT:EXON 1|1-128:0| PROS 1->112|PS00430|TONB_DEPENDENT_REC_1|PDOC00354| NREPEAT 1 REPEAT 2|4->53|83->128| HM:PFM:NREP 2 HM:PFM:REP 7->50|PF07561|1.9e-15|47.5|40/40|DUF1540| HM:PFM:REP 86->125|PF07561|2.4e-17|52.5|40/40|DUF1540| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------1-1----------------1----1-----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,36-44,127-129| PSIPRED cccccEEEEEEcccEEEccccccccccEEEEEcccccccccHHHHHHHccHHHccHHHHHHHHHccccccEEEccccccccccccEEEEEEccEEEccccEEEEEEEEEEcccccccccccEEEEEEc //