[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49038.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:208 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->77 PF09794 * Avl9 9e-05 24.7 %
:HMM:PFM   38->102 PF05651 * Diacid_rec 0.00024 21.3 61/135  
:HMM:PFM   6->61 PF10392 * COG5 8.8e-05 20.0 55/132  
:BLT:SWISS 1->60 TMCC1_MOUSE 2e-04 30.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49038.1 GT:GENE ABO49038.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(533866..534492) GB:FROM 533866 GB:TO 534492 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49038.1 GB:DB_XREF GI:134051067 LENGTH 208 SQ:AASEQ MFQEYRQIVYRIKGLDKPLSSLTRAERNDVLNLSIRQEEIEKHIGQQIQKSFKELQEGLEVVAEWVRLMKEDAIKALGIGGTPEEVLALEETLAQATSLNMQISGLTLANYSPPEKSEPEKHQQTEEPVKTPIKIIKAERPKHKPTLPVFDSTIDMVENNVDQKIVSKVIKEINESVTAAAPTAYLPEVFNQPRITSQKSRPAKRKKR GT:EXON 1|1-208:0| BL:SWS:NREP 1 BL:SWS:REP 1->60|TMCC1_MOUSE|2e-04|30.0|60/649| RP:PFM:NREP 1 RP:PFM:REP 1->77|PF09794|9e-05|24.7|77/369|Avl9| HM:PFM:NREP 2 HM:PFM:REP 38->102|PF05651|0.00024|21.3|61/135|Diacid_rec| HM:PFM:REP 6->61|PF10392|8.8e-05|20.0|55/132|COG5| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,111-130,194-209| PSIPRED cHHHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccccHHHHHcc //