Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49046.1
DDBJ      :             prophage Lp4 protein 11, DNA replication

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:117 amino acids
:HMM:PFM   5->48 PF04545 * Sigma70_r4 0.00034 19.5 41/50  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49046.1 GT:GENE ABO49046.1 GT:PRODUCT prophage Lp4 protein 11, DNA replication GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 540133..540486 GB:FROM 540133 GB:TO 540486 GB:DIRECTION + GB:PRODUCT prophage Lp4 protein 11, DNA replication GB:NOTE KEGG: lpl:lp_3379 prophage Lp4 protein 11, DNA replication GB:PROTEIN_ID ABO49046.1 GB:DB_XREF GI:134051075 LENGTH 117 SQ:AASEQ MVFDIKQLTPKEQLILSLIPTGHQQAASRASLAKLTGLPEREVREIISGLVVKHGLPIGSCTEPTVGGYFIIQDEADLEVATRHLLPRARAIIRRTRALEKIAQEKFSRQLKLVLED GT:EXON 1|1-117:0| SEG 88->98|raraiirrtra| HM:PFM:NREP 1 HM:PFM:REP 5->48|PF04545|0.00034|19.5|41/50|Sigma70_r4| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,117-118| PSIPRED cccccccccHHHHHHHHHHHccccccccHHHHHHHHcccHHHHHHHHHHHHHHccccEEEEcccccccEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //