[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49055.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:72 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   3->69 PF11148 * DUF2922 1e-09 47.8 %
:HMM:PFM   3->69 PF11148 * DUF2922 1.1e-28 53.7 67/69  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49055.1 GT:GENE ABO49055.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 547039..547257 GB:FROM 547039 GB:TO 547257 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: mta:Moth_1792 hypothetical protein GB:PROTEIN_ID ABO49055.1 GB:DB_XREF GI:134051084 LENGTH 72 SQ:AASEQ MTKTLELIFVNVAGDKVTLRVNDPRDDLQEAEVRTVMDTVVAKNVFTSTGGSLTGVAGARLVTRDVAELNIL GT:EXON 1|1-72:0| RP:PFM:NREP 1 RP:PFM:REP 3->69|PF11148|1e-09|47.8|67/69|DUF2922| HM:PFM:NREP 1 HM:PFM:REP 3->69|PF11148|1.1e-28|53.7|67/69|DUF2922| OP:NHOMO 18 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------1------------------------------------------------------------------------------------------------------12-1------------11------------11--131--111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED ccEEEEEEEEcccccEEEEEcccccccccHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEccEEEEEEEc //