[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49060.1
DDBJ      :             type III restriction enzyme, res subunit
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  128/915 : Eukaryota  2/199 : Viruses  1/175   --->[See Alignment]
c.37.1
:877 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   87->160 2fz4A PDBj 3e-04 36.2 %
:RPS:PDB   65->250 2d7dA PDBj 3e-05 10.4 %
:RPS:SCOP  82->279 1z63A1  c.37.1.19 * 1e-04 15.7 %
:HMM:SCOP  9->300 1z3iX2 c.37.1.19 * 1.3e-20 20.9 %
:HMM:SCOP  205->551 2fwrA1 c.37.1.19 * 8.6e-06 23.4 %
:RPS:PFM   87->242 PF04851 * ResIII 1e-08 31.6 %
:HMM:PFM   54->243 PF04851 * ResIII 4.2e-19 19.1 157/184  
:BLT:SWISS 84->576 T3RE_BACC1 1e-56 38.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49060.1 GT:GENE ABO49060.1 GT:PRODUCT type III restriction enzyme, res subunit GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 555014..557647 GB:FROM 555014 GB:TO 557647 GB:DIRECTION + GB:PRODUCT type III restriction enzyme, res subunit GB:NOTE PFAM: type III restriction enzyme, res subunit KEGG: hdu:HD1690 type III restriction enzyme GB:PROTEIN_ID ABO49060.1 GB:DB_XREF GI:134051089 InterPro:IPR006935 LENGTH 877 SQ:AASEQ MKIKFDSNQQYQLDAIQAIVDVFKGQPRSQGKFEVDLMGLSSGMFNELGVGNHLTPDEDTILANLKEIQEQNGIPQAEALDGMNFSVEMETGTGKTYVYLRTIHELYAQYGFTKFIIVVPSVAIREGVLKNLSITKEHFQGIYGNQPFDYWVYDSKRVSSLRQFASSNQLQILVINIDAFNKKENNVIHKENDRLSGRKPIEFIQATQPIVIVDEPQNMESTQAKEAIQSLNPLCTLRYSATHRHIYNLLYRLDPVKAYDMKLVKRIEVDSVLEEDNFNQPYIRVESIKATKTKITAKLTIDCKQADGVKRTSVSISKNGTDLYELSGNRELYQGYIVDHIDAGSQYIAFTNGVVLNTGQQMGGYNDDIMKVQIRETVKEHLEKELHIYRNLPEGKRLKVLSLFFIDKVANYDDAEGKIRLWFEEVYQELAFKPRYRELNLPPVEAVHSGYFAQSKGKAKDTSGKTKADDEAYQLIMKDKERLLSLEEPVRFIFSHSALREGWDNPNVFQICTLNETKSEMKKRQEIGRGLRLPVDQTGHRVFDTTMNRLTVVANESYEDFARSLQTEIEEECGVQFEGRIDNKRQRRTANLKKGWRMDENFLALWDRIKYKTRYSVKYQTGHLIAQAAQAIKKMPAIESPKIMAQKRGLEITSKGLETRMLSVQETKVGYSGLPVPDLLSYIQRETELTRSTIAQILINSERLADVAVNPQRFLEEATKAIKETLHSIMIDGIQYERIDGAEYEMLLFADPKHEIRGYVNRMLEVKGSIYDAIEFDSEVEKEFAQNLDARQDIKLFIKLPRWFTVETPLGTYNPDWAIVKQAVGEDEKLYLVSETKSTKDLSKLRDSERDKIECGKRHFSALPEVQFKHVKDASEV GT:EXON 1|1-877:0| BL:SWS:NREP 1 BL:SWS:REP 84->576|T3RE_BACC1|1e-56|38.8|459/987| SEG 288->301|ikatktkitaklti| BL:PDB:NREP 1 BL:PDB:REP 87->160|2fz4A|3e-04|36.2|69/206| RP:PDB:NREP 1 RP:PDB:REP 65->250|2d7dA|3e-05|10.4|164/621| RP:PFM:NREP 1 RP:PFM:REP 87->242|PF04851|1e-08|31.6|136/177|ResIII| HM:PFM:NREP 1 HM:PFM:REP 54->243|PF04851|4.2e-19|19.1|157/184|ResIII| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF04851|IPR006935| GO:PFM GO:0005524|"GO:ATP binding"|PF04851|IPR006935| GO:PFM GO:0016787|"GO:hydrolase activity"|PF04851|IPR006935| RP:SCP:NREP 1 RP:SCP:REP 82->279|1z63A1|1e-04|15.7|166/230|c.37.1.19| HM:SCP:REP 9->300|1z3iX2|1.3e-20|20.9|215/0|c.37.1.19|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 205->551|2fwrA1|8.6e-06|23.4|192/0|c.37.1.19|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 152 OP:NHOMOORG 134 OP:PATTERN ---------------------------------1--------1--1---------------------- ---1------------------------------------------1------------------------1--------1-------12-----------------1------------------1---1--1---------1----------------------------------------------1---------1-----1--------------------------1---------------------1----111-----1---------------------------------------------11---111---1--------------33--1---1-----1----211-1--1----11--------1--2-1-------------------------------1----------------------------------------------------------------------------------1--11111111111111--11111111------------1--1---11-1-------11111----------1----1--------------21------1------------2-2111122-----------------1----------------------1-----------1---1---1-------------1----------------1---11111111111-1111-----------------------------------------211-11----2--1-----------1-----------------111311-11-------------------------------1-------------------------------------------------------1 --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------3---------------------------- -----------------------------1------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 173 STR:RPRED 19.7 SQ:SECSTR ################################################################ccTTHHH#HHHccHHHHHHHTTccEEEEEEcTTccHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHGGGcHHHHHHcTTcEEEEEcccEEEEEccEEETTTTEEEccEE###########EEcHHHHHH#HHHHHHHHHHcccEEEEEcGGGGcccccHHHHHHHcEEEETTccccHHHHHHHH################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################### DISOP:02AL 1-1,461-470,839-850| PSIPRED cccccccccHHHHHHHHHHHHHHcccccccccEEEccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccEEEEEEEccccHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEcHHHHHHcccccccccEEEEEEHHHHcHHHHcccccHHHHHccccHHHHHHHcccEEEEEcccccccHHHHHHHHHccccEEEEccccccccccEEEEEcHHHHHHcccEEEEEEcccccccccccEEEEEEEEEEccEEEEEEEEEEEEcccccEEEEEEEccccccHHHHcccHHHHcccEEEEEEccccEEEEcccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEcccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccccEEEcccccHHHHHHHHHHHHHHHccccccccEEEEEEEcccccccccccHHEEEEEEcccccHHHHHHHHHHHHccccccccccccccccEEEEEEcccHHHHHHHHHHHHHHHcccccccccccccccccccccHHHcccHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHcccccccEEEEEEEccccccccccccccccccccccHHHccHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHccHHHHHHHHHHHHHHHHHHHHHccEEEEEcccccccccccEEcccccccccccccccccccccEEEEccHHHHHHHHHccccccEEEEEEccccEEEEEccccccccEEEEEEEcccccEEEEEEEEcccccHHHccHHHHHHHHHHHHHHHHHccccEEEEEHHccc //